Date |
Category |
Site |
Headlines |
Dec 30 |
Social |
... |
... |
Dec 30 |
Social |
... |
... |
Dec 30 |
Social |
... |
... |
Dec 30 |
Social |
... |
... |
Dec 30 |
Social |
... |
... |
Dec 29 |
Social |
... |
... |
Dec 29 |
Social |
... |
... |
Dec 29 |
Social |
... |
... |
Dec 28 |
Social |
... |
... |
Dec 28 |
Social |
... |
... |
Dec 28 |
Social |
... |
... |
Dec 28 |
Social |
... |
... |
Dec 28 |
Social |
... |
... |
Dec 27 |
Social |
... |
... |
Dec 27 |
Social |
... |
... |
Dec 27 |
Social |
... |
... |
Dec 27 |
Social |
... |
... |
Dec 27 |
Social |
... |
... |
Dec 27 |
Social |
... |
... |
Dec 27 |
Social |
... |
... |
Dec 27 |
Social |
... |
... |
Dec 27 |
Social |
... |
... |
Dec 26 |
Social |
... |
... |
Dec 26 |
Social |
... |
... |
Dec 26 |
Social |
... |
... |
Dec 26 |
Social |
... |
... |
Dec 26 |
Social |
... |
... |
Dec 26 |
Social |
... |
... |
Dec 25 |
Videos |
... |
... |
Dec 25 |
Social |
... |
... |
Dec 24 |
Social |
... |
... |
Dec 24 |
Videos |
... |
... |
Dec 24 |
Social |
... |
... |
Dec 24 |
Social |
... |
... |
Dec 24 |
Forums |
... |
... |
Dec 24 |
Social |
... |
... |
Dec 24 |
Social |
... |
... |
Dec 24 |
Social |
... |
... |
Dec 23 |
Social |
... |
... |
Dec 23 |
Videos |
... |
... |
Dec 23 |
Social |
... |
... |
Dec 23 |
Social |
... |
... |
Dec 23 |
Social |
... |
... |
Dec 23 |
Social |
... |
... |
Dec 23 |
Social |
... |
... |
Dec 23 |
Social |
... |
... |
Dec 22 |
Social |
... |
... |
Dec 22 |
Social |
... |
... |
Dec 22 |
Social |
... |
... |
Dec 22 |
Social |
... |
... |
Dec 21 |
Social |
... |
... |
Dec 21 |
Videos |
... |
... |
Dec 20 |
Social |
... |
... |
Dec 20 |
Social |
... |
... |
Dec 19 |
Social |
... |
... |
Dec 19 |
Social |
... |
... |
Dec 19 |
Social |
... |
... |
Dec 18 |
Social |
... |
... |
Dec 18 |
Social |
... |
... |
Dec 18 |
Social |
... |
... |
Dec 17 |
Social |
... |
... |
Dec 17 |
Social |
... |
... |
Dec 17 |
Social |
... |
... |
Dec 17 |
Social |
... |
... |
Dec 17 |
Social |
... |
... |
Dec 17 |
Social |
... |
... |
Dec 17 |
Social |
... |
... |
Dec 16 |
Social |
... |
... |
Dec 16 |
Social |
... |
... |
Dec 16 |
Social |
... |
... |
Dec 16 |
Social |
... |
... |
Dec 16 |
Social |
... |
... |
Dec 16 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Videos |
... |
... |
Dec 15 |
Videos |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Social |
... |
... |
Dec 15 |
Videos |
... |
... |
Dec 14 |
Social |
... |
... |
Dec 14 |
Social |
... |
... |
Dec 14 |
Forums |
... |
... |
Dec 14 |
Social |
... |
... |
Dec 14 |
Social |
... |
... |
Dec 14 |
Social |
... |
... |
Dec 14 |
Social |
... |
... |
Dec 14 |
Social |
... |
... |
Dec 14 |
Social |
... |
... |
Dec 13 |
Social |
... |
... |
Dec 13 |
Social |
... |
... |
Dec 13 |
Videos |
... |
... |
Dec 13 |
Social |
... |
... |
Dec 13 |
Social |
... |
... |
Dec 12 |
Social |
... |
... |
Dec 12 |
Social |
... |
... |
Dec 12 |
Social |
... |
... |
Dec 11 |
Social |
... |
... |
Dec 11 |
Social |
... |
... |
Dec 11 |
Social |
... |
... |
Dec 11 |
Social |
... |
... |
Dec 11 |
Social |
... |
... |
Dec 11 |
Social |
... |
... |
Dec 11 |
Social |
... |
... |
Dec 10 |
Videos |
... |
... |
Dec 10 |
Social |
... |
... |
Dec 10 |
Social |
... |
... |
Dec 9 |
Social |
... |
... |
Dec 9 |
Social |
... |
... |
Dec 8 |
Social |
... |
... |
Dec 8 |
Social |
... |
... |
Dec 8 |
Social |
... |
... |
Dec 8 |
Social |
... |
... |
Dec 8 |
Social |
... |
... |
Dec 7 |
Social |
... |
... |
Dec 7 |
Videos |
... |
... |
Dec 7 |
Social |
... |
... |
Dec 7 |
Social |
... |
... |
Dec 6 |
Social |
... |
... |
Dec 6 |
Social |
... |
... |
Dec 6 |
Social |
... |
... |
Dec 6 |
Social |
... |
... |
Dec 6 |
Social |
... |
... |
Dec 6 |
Social |
... |
... |
Dec 5 |
Forums |
... |
... |
Dec 5 |
Social |
... |
... |
Dec 5 |
Social |
... |
... |
Dec 5 |
Social |
... |
... |
Dec 4 |
Social |
... |
... |
Dec 4 |
Social |
... |
... |
Dec 4 |
Social |
... |
... |
Dec 4 |
Social |
... |
... |
Dec 4 |
Social |
... |
... |
Dec 4 |
Social |
... |
... |
Dec 4 |
Social |
... |
... |
Dec 3 |
Social |
... |
... |
Dec 3 |
Social |
... |
... |
Dec 3 |
Social |
... |
... |
Dec 3 |
Forums |
... |
... |
Dec 3 |
Social |
... |
... |
Dec 3 |
Forums |
... |
... |
Dec 3 |
Social |
... |
... |
Dec 3 |
Social |
... |
... |
Dec 3 |
Social |
... |
... |
Dec 2 |
Forums |
... |
... |
Dec 2 |
Social |
... |
... |
Dec 2 |
Social |
... |
... |
Dec 2 |
Social |
... |
... |
Dec 2 |
Forums |
... |
... |
Dec 2 |
Social |
... |
... |
Dec 2 |
Social |
... |
... |
Dec 2 |
Social |
... |
... |
Dec 2 |
Social |
... |
... |
Dec 1 |
Videos |
... |
... |
Dec 1 |
Social |
... |
... |
Dec 1 |
Social |
... |
... |
Dec 1 |
Forums |
... |
... |
Dec 1 |
Social |
... |
... |
Dec 1 |
Forums |
... |
... |
Dec 1 |
Social |
... |
... |
Nov 30 |
Social |
... |
... |
Nov 30 |
Social |
... |
... |
Nov 30 |
Social |
... |
... |
Nov 30 |
Social |
... |
... |
Nov 30 |
Social |
... |
... |
Nov 30 |
Social |
... |
... |
Nov 30 |
Social |
... |
... |
Nov 29 |
Social |
... |
... |
Nov 29 |
Social |
... |
... |
Nov 29 |
Social |
... |
... |
Nov 29 |
Social |
... |
... |
Nov 29 |
Social |
... |
... |
Nov 29 |
Social |
... |
... |
Nov 29 |
Social |
... |
... |
Nov 28 |
Social |
... |
... |
Nov 28 |
Social |
... |
... |
Nov 28 |
Social |
... |
... |
Nov 28 |
Social |
... |
... |
Nov 28 |
Social |
... |
... |
Nov 28 |
Social |
... |
... |
Nov 27 |
Social |
... |
... |
Nov 27 |
Social |
... |
... |
Nov 27 |
Social |
... |
... |
Nov 27 |
Social |
... |
... |
Nov 27 |
Social |
... |
... |
Nov 27 |
Social |
... |
... |
Nov 27 |
Social |
... |
... |
Nov 26 |
Social |
... |
... |
Nov 25 |
Social |
... |
... |
Nov 25 |
Videos |
... |
... |
Nov 25 |
Press |
... |
... |
Nov 25 |
Social |
... |
... |
Nov 25 |
Social |
... |
... |
Nov 25 |
Social |
... |
... |
Nov 25 |
Social |
... |
... |
Nov 25 |
Social |
... |
... |
Nov 24 |
Social |
... |
... |
Nov 24 |
Social |
... |
... |
Nov 23 |
Social |
... |
... |
Nov 23 |
Social |
... |
... |
Nov 23 |
Social |
... |
... |
Nov 23 |
Social |
... |
... |
Nov 22 |
Forums |
... |
... |
Nov 22 |
Social |
... |
... |
Nov 22 |
Forums |
... |
... |
Nov 22 |
Forums |
... |
... |
Nov 22 |
Social |
... |
... |
Nov 22 |
Social |
... |
... |
Nov 22 |
Social |
... |
... |
Nov 22 |
Forums |
... |
... |
Nov 22 |
Forums |
... |
... |
Nov 21 |
Forums |
... |
... |
Nov 21 |
Social |
... |
... |
Nov 21 |
Forums |
... |
... |
Nov 21 |
Forums |
... |
... |
Nov 21 |
Social |
... |
... |
Nov 20 |
Social |
... |
... |
Nov 20 |
Social |
... |
... |
Nov 20 |
Forums |
... |
... |
Nov 19 |
Videos |
... |
... |
Nov 19 |
Videos |
... |
... |
Nov 19 |
Videos |
... |
... |
Nov 19 |
Social |
... |
... |
Nov 19 |
Social |
... |
... |
Nov 19 |
Social |
... |
... |
Nov 19 |
Social |
... |
... |
Nov 19 |
Videos |
... |
... |
Nov 19 |
Social |
... |
... |
Nov 19 |
Social |
... |
... |
Nov 19 |
Social |
... |
... |
Nov 18 |
Social |
... |
... |
Nov 18 |
Social |
... |
... |
Nov 18 |
Social |
... |
... |
Nov 18 |
Social |
... |
... |
Nov 17 |
Videos |
... |
... |
Nov 17 |
Videos |
... |
... |
Nov 17 |
Social |
... |
... |
Nov 17 |
Social |
... |
... |
Nov 17 |
Social |
... |
... |
Nov 16 |
Social |
... |
... |
Nov 16 |
Social |
... |
... |
Nov 16 |
Social |
... |
... |
Nov 16 |
Social |
... |
... |
Nov 16 |
Videos |
... |
... |
Nov 15 |
Social |
... |
... |
Nov 14 |
Social |
... |
... |
Nov 14 |
Social |
... |
... |
Nov 14 |
Social |
... |
... |
Nov 14 |
Social |
... |
... |
Nov 14 |
Social |
... |
... |
Nov 13 |
Social |
... |
... |
Nov 13 |
Social |
... |
... |
Nov 13 |
Social |
... |
... |
Nov 13 |
Videos |
... |
... |
Nov 12 |
Social |
... |
... |
Nov 12 |
Social |
... |
... |
Nov 12 |
Social |
... |
... |
Nov 12 |
Forums |
... |
... |
Nov 12 |
Social |
... |
... |
Nov 12 |
Social |
... |
... |
Nov 12 |
Social |
... |
... |
Nov 11 |
Social |
... |
... |
Nov 11 |
Forums |
... |
... |
Nov 11 |
Forums |
... |
... |
Nov 11 |
Videos |
... |
... |
Nov 11 |
Videos |
... |
... |
Nov 11 |
Videos |
... |
... |
Nov 11 |
Social |
... |
... |
Nov 11 |
Social |
... |
... |
Nov 11 |
Social |
... |
... |
Nov 10 |
Social |
... |
... |
Nov 10 |
Forums |
... |
... |
Nov 10 |
Social |
... |
... |
Nov 10 |
Social |
... |
... |
Nov 10 |
Forums |
... |
... |
Nov 9 |
Social |
... |
... |
Nov 9 |
Social |
... |
... |
Nov 9 |
Social |
... |
... |
Nov 9 |
Social |
... |
... |
Nov 9 |
Social |
... |
... |
Nov 9 |
Social |
... |
... |
Nov 8 |
Social |
... |
... |
Nov 8 |
Social |
... |
... |
Nov 8 |
Social |
... |
... |
Nov 8 |
Social |
... |
... |
Nov 8 |
Social |
... |
... |
Nov 7 |
Social |
... |
... |
Nov 7 |
Social |
... |
... |
Nov 7 |
Social |
... |
... |
Nov 7 |
Social |
... |
... |
Nov 6 |
Social |
... |
... |
Nov 6 |
Forums |
... |
... |
Nov 6 |
Social |
... |
... |
Nov 6 |
Social |
... |
... |
Nov 6 |
Social |
... |
... |
Nov 6 |
Social |
... |
... |
Nov 5 |
Social |
... |
... |
Nov 5 |
Social |
... |
... |
Nov 5 |
Social |
... |
... |
Nov 5 |
Social |
... |
... |
Nov 5 |
Social |
... |
... |
Nov 5 |
Social |
... |
... |
Nov 5 |
Social |
... |
... |
Nov 5 |
Social |
... |
... |
Nov 5 |
Social |
... |
... |
Nov 5 |
Social |
... |
... |
Nov 4 |
Social |
... |
... |
Nov 4 |
Social |
... |
... |
Nov 4 |
Social |
... |
... |
Nov 4 |
Social |
... |
... |
Nov 4 |
Social |
... |
... |
Nov 3 |
Social |
... |
... |
Nov 3 |
Social |
... |
... |
Nov 2 |
Social |
... |
... |
Nov 2 |
Social |
... |
... |
Nov 2 |
Social |
... |
... |
Nov 2 |
Social |
... |
... |
Nov 1 |
Social |
... |
... |
Nov 1 |
Forums |
... |
... |
Oct 31 |
Videos |
... |
... |
Oct 31 |
Social |
... |
... |
Oct 31 |
News |
... |
... |
Oct 31 |
Social |
... |
... |
Oct 30 |
Social |
... |
... |
Oct 30 |
Social |
... |
... |
Oct 30 |
Videos |
... |
... |
Oct 30 |
Social |
... |
... |
Oct 30 |
Social |
... |
... |
Oct 30 |
Social |
... |
... |
Oct 30 |
Social |
... |
... |
Oct 30 |
News |
... |
... |
Oct 29 |
Social |
... |
... |
Oct 28 |
Social |
... |
... |
Oct 28 |
Social |
... |
... |
Oct 28 |
Social |
... |
... |
Oct 28 |
Social |
... |
... |
Oct 28 |
Social |
... |
... |
Oct 28 |
Social |
... |
... |
Oct 27 |
Social |
... |
... |
Oct 27 |
Social |
... |
... |
Oct 27 |
Social |
... |
... |
Oct 26 |
Social |
... |
... |
Oct 25 |
Videos |
... |
... |
Oct 25 |
Social |
... |
... |
Oct 25 |
Social |
... |
... |
Oct 24 |
Social |
... |
... |
Oct 24 |
Social |
... |
... |
Oct 23 |
Social |
... |
... |
Oct 23 |
Social |
... |
... |
Oct 23 |
Social |
... |
... |
Oct 23 |
Social |
... |
... |
Oct 23 |
Social |
... |
... |
Oct 23 |
Social |
... |
... |
Oct 23 |
Social |
... |
... |
Oct 22 |
Videos |
... |
... |
Oct 22 |
Social |
... |
... |
Oct 22 |
Forums |
... |
... |
Oct 22 |
Social |
... |
... |
Oct 22 |
Social |
... |
... |
Oct 22 |
Social |
... |
... |
Oct 22 |
Social |
... |
... |
Oct 22 |
Social |
... |
... |
Oct 22 |
Videos |
... |
... |
Oct 22 |
Forums |
... |
... |
Oct 21 |
Social |
... |
... |
Oct 21 |
Social |
... |
... |
Oct 21 |
Social |
... |
... |
Oct 21 |
Social |
... |
... |
Oct 21 |
Social |
... |
... |
Oct 21 |
Social |
... |
... |
Oct 20 |
Forums |
... |
... |
Oct 20 |
Social |
... |
... |
Oct 20 |
Social |
... |
... |
Oct 20 |
Social |
... |
... |
Oct 20 |
Social |
... |
... |
Oct 19 |
Social |
... |
... |
Oct 19 |
Social |
... |
... |
Oct 19 |
Social |
... |
... |
Oct 19 |
Social |
... |
... |
Oct 19 |
Social |
... |
... |
Oct 19 |
Social |
... |
... |
Oct 19 |
Videos |
... |
... |
Oct 18 |
Social |
... |
... |
Oct 18 |
Social |
... |
... |
Oct 18 |
Forums |
... |
... |
Oct 18 |
Social |
... |
... |
Oct 17 |
Social |
... |
... |
Oct 17 |
Social |
... |
... |
Oct 17 |
Social |
... |
... |
Oct 17 |
Social |
... |
... |
Oct 17 |
Social |
... |
... |
Oct 17 |
Social |
... |
... |
Oct 17 |
Social |
... |
... |
Oct 16 |
Social |
... |
... |
Oct 16 |
Social |
... |
... |
Oct 16 |
Social |
... |
... |
Oct 15 |
Social |
... |
... |
Oct 15 |
Social |
... |
... |
Oct 15 |
Social |
... |
... |
Oct 15 |
Social |
... |
... |
Oct 15 |
Social |
... |
... |
Oct 15 |
Social |
... |
... |
Oct 15 |
Social |
... |
... |
Oct 14 |
Social |
... |
... |
Oct 14 |
Videos |
... |
... |
Oct 14 |
Social |
... |
... |
Oct 14 |
Social |
... |
... |
Oct 14 |
Social |
... |
... |
Oct 14 |
Social |
... |
... |
Oct 13 |
Social |
... |
... |
Oct 13 |
Social |
... |
... |
Oct 13 |
Social |
... |
... |
Oct 13 |
Videos |
... |
... |
Oct 13 |
Social |
... |
... |
Oct 12 |
Social |
... |
... |
Oct 12 |
Social |
... |
... |
Oct 12 |
Social |
... |
... |
Oct 11 |
Social |
... |
... |
Oct 11 |
Social |
... |
... |
Oct 11 |
Social |
... |
... |
Oct 11 |
Social |
... |
... |
Oct 11 |
Social |
... |
... |
Oct 11 |
Social |
... |
... |
Oct 10 |
Social |
... |
... |
Oct 10 |
Social |
... |
... |
Oct 10 |
Social |
... |
... |
Oct 9 |
Social |
... |
... |
Oct 9 |
Social |
... |
... |
Oct 9 |
Social |
... |
... |
Oct 9 |
Social |
... |
... |
Oct 9 |
Social |
... |
... |
Oct 9 |
Social |
... |
... |
Oct 9 |
Social |
... |
... |
Oct 9 |
Social |
... |
... |
Oct 9 |
Social |
... |
... |
Oct 8 |
Social |
... |
... |
Oct 8 |
Videos |
... |
... |
Oct 8 |
Social |
... |
... |
Oct 8 |
Social |
... |
... |
Oct 8 |
Videos |
... |
... |
Oct 8 |
Social |
... |
... |
Oct 8 |
Videos |
... |
... |
Oct 8 |
Social |
... |
... |
Oct 7 |
Social |
... |
... |
Oct 7 |
Social |
... |
... |
Oct 7 |
Social |
... |
... |
Oct 7 |
Social |
... |
... |
Oct 6 |
Social |
... |
... |
Oct 6 |
Social |
... |
... |
Oct 6 |
Social |
... |
... |
Oct 6 |
Social |
... |
... |
Oct 6 |
Social |
... |
... |
Oct 6 |
Social |
... |
... |
Oct 6 |
News |
... |
... |
Oct 6 |
Social |
... |
... |
Oct 5 |
Social |
... |
... |
Oct 5 |
Social |
... |
... |
Oct 5 |
Social |
... |
... |
Oct 5 |
Social |
... |
... |
Oct 5 |
Social |
... |
... |
Oct 4 |
Social |
... |
... |
Oct 4 |
Social |
... |
... |
Oct 4 |
Social |
... |
... |
Oct 3 |
Social |
... |
... |
Oct 3 |
Social |
... |
... |
Oct 3 |
Social |
... |
... |
Oct 2 |
Social |
... |
... |
Oct 2 |
Forums |
... |
... |
Oct 2 |
Social |
... |
... |
Oct 1 |
Social |
... |
... |
Oct 1 |
Social |
... |
... |
Oct 1 |
Social |
... |
... |
Oct 1 |
Social |
... |
... |
Oct 1 |
Social |
... |
... |
Oct 1 |
Social |
... |
... |
Oct 1 |
Social |
... |
... |
Oct 1 |
Social |
... |
... |
Sep 30 |
Forums |
... |
... |
Sep 30 |
Social |
... |
... |
Sep 30 |
Social |
... |
... |
Sep 30 |
Social |
... |
... |
Sep 29 |
Social |
... |
... |
Sep 29 |
Social |
... |
... |
Sep 29 |
Social |
... |
... |
Sep 29 |
Social |
... |
... |
Sep 28 |
Videos |
... |
... |
Sep 28 |
Social |
... |
... |
Sep 28 |
Social |
... |
... |
Sep 28 |
Social |
... |
... |
Sep 28 |
Social |
... |
... |
Sep 28 |
Social |
... |
... |
Sep 28 |
Social |
... |
... |
Sep 27 |
Videos |
... |
... |
Sep 27 |
Social |
... |
... |
Sep 26 |
Social |
... |
... |
Sep 26 |
Social |
... |
... |
Sep 26 |
Social |
... |
... |
Sep 26 |
Social |
... |
... |
Sep 26 |
Social |
... |
... |
Sep 26 |
Social |
... |
... |
Sep 25 |
Social |
... |
... |
Sep 25 |
Forums |
... |
... |
Sep 25 |
Social |
... |
... |
Sep 25 |
Social |
... |
... |
Sep 25 |
Social |
... |
... |
Sep 25 |
Social |
... |
... |
Sep 25 |
Social |
... |
... |
Sep 25 |
Social |
... |
... |
Sep 25 |
Social |
... |
... |
Sep 25 |
Social |
... |
... |
Sep 24 |
Videos |
... |
... |
Sep 24 |
Social |
... |
... |
Sep 24 |
Social |
... |
... |
Sep 23 |
Videos |
... |
... |
Sep 23 |
Videos |
... |
... |
Sep 23 |
Social |
... |
... |
Sep 23 |
Social |
... |
... |
Sep 22 |
Social |
... |
... |
Sep 22 |
Social |
... |
... |
Sep 22 |
Social |
... |
... |
Sep 22 |
Social |
... |
... |
Sep 22 |
Social |
... |
... |
Sep 22 |
Forums |
... |
... |
Sep 22 |
Social |
... |
... |
Sep 22 |
Social |
... |
... |
Sep 22 |
Social |
... |
... |
Sep 22 |
Videos |
... |
... |
Sep 21 |
Social |
... |
... |
Sep 21 |
Social |
... |
... |
Sep 20 |
Social |
... |
... |
Sep 20 |
Social |
... |
... |
Sep 20 |
Social |
... |
... |
Sep 19 |
Social |
... |
... |
Sep 19 |
Social |
... |
... |
Sep 19 |
Videos |
... |
... |
Sep 19 |
Social |
... |
... |
Sep 18 |
Social |
... |
... |
Sep 18 |
Social |
... |
... |
Sep 18 |
Forums |
... |
... |
Sep 18 |
Social |
... |
... |
Sep 18 |
Social |
... |
... |
Sep 18 |
Social |
... |
... |
Sep 18 |
Social |
... |
... |
Sep 17 |
Social |
... |
... |
Sep 17 |
Social |
... |
... |
Sep 17 |
Social |
... |
... |
Sep 17 |
Social |
... |
... |
Sep 17 |
Social |
... |
... |
Sep 16 |
Forums |
... |
... |
Sep 16 |
Social |
... |
... |
Sep 16 |
Social |
... |
... |
Sep 16 |
Social |
... |
... |
Sep 16 |
Social |
... |
... |
Sep 16 |
Social |
... |
... |
Sep 16 |
Social |
... |
... |
Sep 16 |
Social |
... |
... |
Sep 16 |
Social |
... |
... |
Sep 15 |
Forums |
... |
... |
Sep 15 |
Forums |
... |
... |
Sep 15 |
News |
... |
... |
Sep 15 |
Forums |
... |
... |
Sep 15 |
Forums |
... |
... |
Sep 15 |
Forums |
... |
... |
Sep 15 |
Forums |
... |
... |
Sep 15 |
Social |
... |
... |
Sep 15 |
Social |
... |
... |
Sep 14 |
Social |
... |
... |
Sep 14 |
Forums |
... |
... |
Sep 14 |
Social |
... |
... |
Sep 14 |
Social |
... |
... |
Sep 14 |
Forums |
... |
... |
Sep 14 |
Forums |
... |
... |
Sep 13 |
Social |
... |
... |
Sep 13 |
Social |
... |
... |
Sep 13 |
Social |
... |
... |
Sep 13 |
Social |
... |
... |
Sep 13 |
Forums |
... |
... |
Sep 13 |
Social |
... |
... |
Sep 12 |
Social |
... |
... |
Sep 12 |
Social |
... |
... |
Sep 12 |
Social |
... |
... |
Sep 12 |
Social |
... |
... |
Sep 12 |
Social |
... |
... |
Sep 12 |
Social |
... |
... |
Sep 12 |
Social |
... |
... |
Sep 12 |
Social |
... |
... |
Sep 12 |
Social |
... |
... |
Sep 11 |
Forums |
... |
... |
Sep 11 |
Videos |
... |
... |
Sep 11 |
Social |
... |
... |
Sep 11 |
Social |
... |
... |
Sep 11 |
Social |
... |
... |
Sep 11 |
Social |
... |
... |
Sep 11 |
Social |
... |
... |
Sep 11 |
Social |
... |
... |
Sep 11 |
Forums |
... |
... |
Sep 11 |
Social |
... |
... |
Sep 11 |
Social |
... |
... |
Sep 10 |
Social |
... |
... |
Sep 10 |
Social |
... |
... |
Sep 10 |
Social |
... |
... |
Sep 9 |
Forums |
... |
... |
Sep 9 |
Social |
... |
... |
Sep 9 |
Videos |
... |
... |
Sep 9 |
Social |
... |
... |
Sep 9 |
Social |
... |
... |
Sep 9 |
Social |
... |
... |
Sep 8 |
Social |
... |
... |
Sep 8 |
Social |
... |
... |
Sep 8 |
Social |
... |
... |
Sep 8 |
Social |
... |
... |
Sep 8 |
Social |
... |
... |
Sep 8 |
Forums |
... |
... |
Sep 8 |
Social |
... |
... |
Sep 7 |
Social |
... |
... |
Sep 7 |
Social |
... |
... |
Sep 6 |
Social |
... |
... |
Sep 6 |
Social |
... |
... |
Sep 6 |
Videos |
... |
... |
Sep 6 |
Social |
... |
... |
Sep 6 |
Forums |
... |
... |
Sep 6 |
Social |
... |
... |
Sep 6 |
Social |
... |
... |
Sep 6 |
Social |
... |
... |
Sep 6 |
Social |
... |
... |
Sep 5 |
Social |
... |
... |
Sep 5 |
Social |
... |
... |
Sep 5 |
Social |
... |
... |
Sep 5 |
Social |
... |
... |
Sep 5 |
Social |
... |
... |
Sep 5 |
Social |
... |
... |
Sep 5 |
Social |
... |
... |
Sep 5 |
Social |
... |
... |
Sep 5 |
Social |
... |
... |
Sep 5 |
Social |
... |
... |
Sep 5 |
Social |
... |
... |
Sep 5 |
Social |
... |
... |
Sep 4 |
Social |
... |
... |
Sep 4 |
Social |
... |
... |
Sep 4 |
Social |
... |
... |
Sep 4 |
Social |
... |
... |
Sep 4 |
Social |
... |
... |
Sep 4 |
Social |
... |
... |
Sep 4 |
Forums |
... |
... |
Sep 4 |
Forums |
... |
... |
Sep 4 |
Forums |
... |
... |
Sep 4 |
Social |
... |
... |
Sep 4 |
Social |
... |
... |
Sep 4 |
Social |
... |
... |
Sep 4 |
Forums |
... |
... |
Sep 4 |
Forums |
... |
... |
Sep 4 |
Social |
... |
... |
Sep 4 |
Social |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 3 |
Videos |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 3 |
Forums |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 3 |
Social |
... |
... |
Sep 2 |
Social |
... |
... |
Sep 2 |
Videos |
... |
... |
Sep 2 |
Social |
... |
... |
Sep 2 |
Social |
... |
... |
Sep 2 |
Social |
... |
... |
Sep 2 |
Social |
... |
... |
Sep 2 |
Social |
... |
... |
Sep 2 |
Social |
... |
... |
Sep 2 |
Social |
... |
... |
Sep 2 |
Social |
... |
... |
Sep 2 |
Social |
... |
... |
Sep 1 |
Social |
... |
... |
Sep 1 |
Social |
... |
... |
Sep 1 |
Social |
... |
... |
Sep 1 |
Social |
... |
... |
Sep 1 |
Social |
... |
... |
Sep 1 |
Social |
... |
... |
Aug 31 |
Social |
... |
... |
Aug 31 |
Videos |
... |
... |
Aug 31 |
Videos |
... |
... |
Aug 31 |
Videos |
... |
... |
Aug 31 |
Social |
... |
... |
Aug 31 |
Social |
... |
... |
Aug 31 |
Press |
... |
... |
Aug 31 |
Social |
... |
... |
Aug 31 |
Videos |
... |
... |
Aug 31 |
Forums |
... |
... |
Aug 31 |
Social |
... |
... |
Aug 31 |
Social |
... |
... |
Aug 31 |
Social |
... |
... |
Aug 31 |
Social |
... |
... |
Aug 30 |
Social |
... |
... |
Aug 30 |
Social |
... |
... |
Aug 30 |
Forums |
... |
... |
Aug 30 |
Social |
... |
... |
Aug 30 |
Social |
... |
... |
Aug 30 |
Social |
... |
... |
Aug 30 |
Social |
... |
... |
Aug 30 |
Social |
... |
... |
Aug 30 |
Social |
... |
... |
Aug 30 |
Social |
... |
... |
Aug 30 |
Social |
... |
... |
Aug 30 |
Videos |
... |
... |
Aug 29 |
Forums |
... |
... |
Aug 29 |
Social |
... |
... |
Aug 29 |
Social |
... |
... |
Aug 29 |
Social |
... |
... |
Aug 29 |
Social |
... |
... |
Aug 29 |
Social |
... |
... |
Aug 29 |
Social |
... |
... |
Aug 29 |
Social |
... |
... |
Aug 29 |
Social |
... |
... |
Aug 29 |
Social |
... |
... |
Aug 29 |
Social |
... |
... |
Aug 29 |
Social |
... |
... |
Aug 29 |
Social |
... |
... |
Aug 29 |
Social |
... |
... |
Aug 28 |
Social |
... |
... |
Aug 28 |
Social |
... |
... |
Aug 28 |
Social |
... |
... |
Aug 28 |
Social |
... |
... |
Aug 28 |
Social |
... |
... |
Aug 28 |
Social |
... |
... |
Aug 28 |
Social |
... |
... |
Aug 28 |
Social |
... |
... |
Aug 28 |
Social |
... |
... |
Aug 28 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 27 |
Social |
... |
... |
Aug 26 |
Social |
... |
... |
Aug 26 |
Social |
... |
... |
Aug 26 |
Social |
... |
... |
Aug 26 |
Social |
... |
... |
Aug 26 |
Social |
... |
... |
Aug 26 |
Social |
... |
... |
Aug 26 |
Social |
... |
... |
Aug 26 |
Social |
... |
... |
Aug 26 |
Social |
... |
... |
Aug 26 |
Social |
... |
... |
Aug 26 |
Forums |
... |
... |
Aug 26 |
Social |
... |
... |
Aug 26 |
Social |
... |
... |
Aug 25 |
Forums |
... |
... |
Aug 25 |
Social |
... |
... |
Aug 25 |
Social |
... |
... |
Aug 25 |
Social |
... |
... |
Aug 25 |
Social |
... |
... |
Aug 25 |
Social |
... |
... |
Aug 24 |
Social |
... |
... |
Aug 24 |
Social |
... |
... |
Aug 24 |
Social |
... |
... |
Aug 24 |
Social |
... |
... |
Aug 24 |
Social |
... |
... |
Aug 24 |
Social |
... |
... |
Aug 24 |
Social |
... |
... |
Aug 24 |
Social |
... |
... |
Aug 24 |
Social |
... |
... |
Aug 23 |
Social |
... |
... |
Aug 23 |
Social |
... |
... |
Aug 23 |
Social |
... |
... |
Aug 23 |
Social |
... |
... |
Aug 23 |
Social |
... |
... |
Aug 23 |
News |
... |
... |
Aug 23 |
Social |
... |
... |
Aug 23 |
Social |
... |
... |
Aug 23 |
Videos |
... |
... |
Aug 23 |
Social |
... |
... |
Aug 22 |
Videos |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Videos |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Forums |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 22 |
Social |
... |
... |
Aug 21 |
Social |
... |
... |
Aug 21 |
Social |
... |
... |
Aug 21 |
Videos |
... |
... |
Aug 21 |
Social |
... |
... |
Aug 21 |
Social |
... |
... |
Aug 21 |
Social |
... |
... |
Aug 21 |
Social |
... |
... |
Aug 21 |
Social |
... |
... |
Aug 21 |
Social |
... |
... |
Aug 21 |
Social |
... |
... |
Aug 21 |
Social |
... |
... |
Aug 21 |
Social |
... |
... |
Aug 21 |
Social |
... |
... |
Aug 21 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 20 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Social |
... |
... |
Aug 19 |
Forums |
... |
... |
Aug 18 |
Social |
... |
... |
Aug 18 |
Social |
... |
... |
Aug 18 |
Social |
... |
... |
Aug 18 |
Social |
... |
... |
Aug 18 |
Social |
... |
... |
Aug 18 |
Social |
... |
... |
Aug 18 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Videos |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 17 |
Social |
... |
... |
Aug 16 |
Forums |
... |
... |
Aug 16 |
Videos |
... |
... |
Aug 16 |
Social |
... |
... |
Aug 16 |
Social |
... |
... |
Aug 16 |
Social |
... |
... |
Aug 16 |
Social |
... |
... |
Aug 16 |
Social |
... |
... |
Aug 16 |
Social |
... |
... |
Aug 16 |
Social |
... |
... |
Aug 16 |
Social |
... |
... |
Aug 16 |
Social |
... |
... |
Aug 16 |
Social |
... |
... |
Aug 16 |
Social |
... |
... |
Aug 16 |
Social |
... |
... |
Aug 16 |
Social |
... |
... |
Aug 15 |
Social |
... |
... |
Aug 15 |
Social |
... |
... |
Aug 15 |
Social |
... |
... |
Aug 15 |
Social |
... |
... |
Aug 15 |
Social |
... |
... |
Aug 15 |
Social |
... |
... |
Aug 15 |
Social |
... |
... |
Aug 15 |
Social |
... |
... |
Aug 15 |
Social |
... |
... |
Aug 15 |
Social |
... |
... |
Aug 15 |
Forums |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 14 |
Forums |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 14 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 13 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 12 |
Social |
... |
... |
Aug 11 |
Social |
... |
... |
Aug 11 |
Social |
... |
... |
Aug 11 |
Videos |
... |
... |
Aug 11 |
Social |
... |
... |
Aug 10 |
Social |
... |
... |
Aug 10 |
Social |
... |
... |
Aug 10 |
Social |
... |
... |
Aug 10 |
Social |
... |
... |
Aug 10 |
Social |
... |
... |
Aug 10 |
Social |
... |
... |
Aug 10 |
Social |
... |
... |
Aug 10 |
Social |
... |
... |
Aug 10 |
Social |
... |
... |
Aug 10 |
Social |
... |
... |
Aug 9 |
Social |
... |
... |
Aug 9 |
Forums |
... |
... |
Aug 9 |
Social |
... |
... |
Aug 9 |
Social |
... |
... |
Aug 9 |
Social |
... |
... |
Aug 9 |
Social |
... |
... |
Aug 9 |
Social |
... |
... |
Aug 9 |
Social |
... |
... |
Aug 9 |
Social |
... |
... |
Aug 9 |
Social |
... |
... |
Aug 8 |
Social |
... |
... |
Aug 8 |
Social |
... |
... |
Aug 8 |
Social |
... |
... |
Aug 7 |
Social |
... |
... |
Aug 7 |
Social |
... |
... |
Aug 7 |
Videos |
... |
... |
Aug 7 |
Social |
... |
... |
Aug 7 |
Social |
... |
... |
Aug 7 |
Social |
... |
... |
Aug 7 |
Social |
... |
... |
Aug 7 |
Social |
... |
... |
Aug 7 |
Social |
... |
... |
Aug 7 |
Social |
... |
... |
Aug 7 |
Videos |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 6 |
Social |
... |
... |
Aug 5 |
Social |
... |
... |
Aug 5 |
Videos |
... |
... |
Aug 5 |
Social |
... |
... |
Aug 5 |
Social |
... |
... |
Aug 5 |
Social |
... |
... |
Aug 5 |
Social |
... |
... |
Aug 5 |
Social |
... |
... |
Aug 5 |
Social |
... |
... |
Aug 5 |
Social |
... |
... |
Aug 5 |
Videos |
... |
... |
Aug 5 |
Social |
... |
... |
Aug 4 |
Social |
... |
... |
Aug 4 |
Social |
... |
... |
Aug 4 |
Social |
... |
... |
Aug 4 |
Social |
... |
... |
Aug 4 |
Social |
... |
... |
Aug 4 |
Social |
... |
... |
Aug 4 |
Social |
... |
... |
Aug 4 |
Forums |
... |
... |
Aug 3 |
Social |
... |
... |
Aug 3 |
Social |
... |
... |
Aug 3 |
Social |
... |
... |
Aug 2 |
Social |
... |
... |
Aug 2 |
Social |
... |
... |
Aug 2 |
Social |
... |
... |
Aug 2 |
Social |
... |
... |
Aug 2 |
Social |
... |
... |
Aug 2 |
Videos |
... |
... |
Aug 2 |
Social |
... |
... |
Aug 2 |
Social |
... |
... |
Aug 2 |
Social |
... |
... |
Aug 2 |
Social |
... |
... |
Aug 2 |
Social |
... |
... |
Aug 2 |
Social |
... |
... |
Aug 2 |
Forums |
... |
... |
Aug 1 |
Videos |
... |
... |
Aug 1 |
Social |
... |
... |
Aug 1 |
Videos |
... |
... |
Aug 1 |
Videos |
... |
... |
Aug 1 |
Social |
... |
... |
Aug 1 |
Social |
... |
... |
Aug 1 |
Social |
... |
... |
Aug 1 |
Social |
... |
... |
Aug 1 |
Videos |
... |
... |
Aug 1 |
Social |
... |
... |
Aug 1 |
Social |
... |
... |
Aug 1 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Forums |
... |
... |
Jul 31 |
Forums |
... |
... |
Jul 31 |
Forums |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 31 |
Social |
... |
... |
Jul 30 |
Social |
... |
... |
Jul 30 |
Social |
... |
... |
Jul 30 |
Social |
... |
... |
Jul 30 |
Social |
... |
... |
Jul 30 |
Social |
... |
... |
Jul 30 |
Social |
... |
... |
Jul 30 |
Social |
... |
... |
Jul 30 |
Social |
... |
... |
Jul 30 |
Social |
... |
... |
Jul 30 |
Social |
... |
... |
Jul 30 |
Social |
... |
... |
Jul 30 |
Social |
... |
... |
Jul 30 |
Forums |
... |
... |
Jul 30 |
Social |
... |
... |
Jul 29 |
Social |
... |
... |
Jul 29 |
Social |
... |
... |
Jul 29 |
Social |
... |
... |
Jul 29 |
Social |
... |
... |
Jul 29 |
Social |
... |
... |
Jul 28 |
Forums |
... |
... |
Jul 28 |
Forums |
... |
... |
Jul 28 |
Social |
... |
... |
Jul 28 |
Social |
... |
... |
Jul 28 |
Social |
... |
... |
Jul 28 |
Social |
... |
... |
Jul 28 |
Social |
... |
... |
Jul 28 |
Social |
... |
... |
Jul 28 |
Social |
... |
... |
Jul 27 |
Social |
... |
... |
Jul 27 |
Social |
... |
... |
Jul 27 |
Social |
... |
... |
Jul 27 |
Social |
... |
... |
Jul 27 |
Social |
... |
... |
Jul 27 |
Social |
... |
... |
Jul 27 |
Social |
... |
... |
Jul 27 |
Social |
... |
... |
Jul 27 |
Forums |
... |
... |
Jul 27 |
Social |
... |
... |
Jul 27 |
Social |
... |
... |
Jul 27 |
Social |
... |
... |
Jul 27 |
Social |
... |
... |
Jul 27 |
Social |
... |
... |
Jul 26 |
Social |
... |
... |
Jul 26 |
Social |
... |
... |
Jul 26 |
Social |
... |
... |
Jul 26 |
Social |
... |
... |
Jul 26 |
Social |
... |
... |
Jul 26 |
Social |
... |
... |
Jul 26 |
Social |
... |
... |
Jul 26 |
Social |
... |
... |
Jul 26 |
Social |
... |
... |
Jul 25 |
Social |
... |
... |
Jul 25 |
Social |
... |
... |
Jul 24 |
Forums |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Forums |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 24 |
Social |
... |
... |
Jul 23 |
Social |
... |
... |
Jul 23 |
Social |
... |
... |
Jul 23 |
Forums |
... |
... |
Jul 23 |
Social |
... |
... |
Jul 23 |
Social |
... |
... |
Jul 23 |
Forums |
... |
... |
Jul 23 |
Forums |
... |
... |
Jul 23 |
Forums |
... |
... |
Jul 23 |
Forums |
... |
... |
Jul 23 |
Forums |
... |
... |
Jul 23 |
Forums |
... |
... |
Jul 23 |
Forums |
... |
... |
Jul 22 |
Social |
... |
... |
Jul 22 |
Social |
... |
... |
Jul 22 |
Social |
... |
... |
Jul 22 |
Social |
... |
... |
Jul 22 |
Social |
... |
... |
Jul 22 |
Social |
... |
... |
Jul 22 |
Social |
... |
... |
Jul 22 |
Social |
... |
... |
Jul 22 |
Social |
... |
... |
Jul 22 |
Social |
... |
... |
Jul 22 |
Social |
... |
... |
Jul 22 |
Social |
... |
... |
Jul 21 |
Social |
... |
... |
Jul 21 |
Social |
... |
... |
Jul 21 |
Social |
... |
... |
Jul 21 |
Social |
... |
... |
Jul 21 |
Social |
... |
... |
Jul 21 |
Social |
... |
... |
Jul 21 |
Social |
... |
... |
Jul 21 |
Social |
... |
... |
Jul 21 |
Social |
... |
... |
Jul 21 |
Social |
... |
... |
Jul 21 |
Social |
... |
... |
Jul 21 |
Social |
... |
... |
Jul 21 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Forums |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
News |
... |
... |
Jul 20 |
News |
... |
... |
Jul 20 |
News |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 20 |
Social |
... |
... |
Jul 19 |
Social |
... |
... |
Jul 19 |
Social |
... |
... |
Jul 19 |
Social |
... |
... |
Jul 19 |
Forums |
... |
... |
Jul 19 |
Social |
... |
... |
Jul 19 |
Social |
... |
... |
Jul 19 |
Social |
... |
... |
Jul 19 |
Social |
... |
... |
Jul 19 |
Social |
... |
... |
Jul 19 |
Social |
... |
... |
Jul 19 |
Social |
... |
... |
Jul 19 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 18 |
Social |
... |
... |
Jul 17 |
Social |
... |
... |
Jul 17 |
Social |
... |
... |
Jul 17 |
Social |
... |
... |
Jul 17 |
Social |
... |
... |
Jul 17 |
Social |
... |
... |
Jul 17 |
Social |
... |
... |
Jul 17 |
Social |
... |
... |
Jul 17 |
Social |
... |
... |
Jul 17 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Videos |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 16 |
Social |
... |
... |
Jul 15 |
Social |
... |
... |
Jul 15 |
Social |
... |
... |
Jul 15 |
Forums |
... |
... |
Jul 15 |
Social |
... |
... |
Jul 15 |
Social |
... |
... |
Jul 15 |
Social |
... |
... |
Jul 15 |
Social |
... |
... |
Jul 14 |
Social |
... |
... |
Jul 14 |
Social |
... |
... |
Jul 14 |
Social |
... |
... |
Jul 14 |
Social |
... |
... |
Jul 13 |
Social |
... |
... |
Jul 13 |
Social |
... |
... |
Jul 13 |
Social |
... |
... |
Jul 13 |
Social |
... |
... |
Jul 13 |
Social |
... |
... |
Jul 13 |
Social |
... |
... |
Jul 13 |
Social |
... |
... |
Jul 13 |
Social |
... |
... |
Jul 13 |
Social |
... |
... |
Jul 13 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Forums |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 12 |
Social |
... |
... |
Jul 11 |
Social |
... |
... |
Jul 11 |
Forums |
... |
... |
Jul 11 |
Forums |
... |
... |
Jul 11 |
Social |
... |
... |
Jul 11 |
Social |
... |
... |
Jul 11 |
Social |
... |
... |
Jul 11 |
Social |
... |
... |
Jul 11 |
Forums |
... |
... |
Jul 11 |
Forums |
... |
... |
Jul 11 |
Forums |
... |
... |
Jul 11 |
Social |
... |
... |
Jul 10 |
Forums |
... |
... |
Jul 10 |
Social |
... |
... |
Jul 10 |
Social |
... |
... |
Jul 10 |
Social |
... |
... |
Jul 10 |
Social |
... |
... |
Jul 10 |
Social |
... |
... |
Jul 10 |
Social |
... |
... |
Jul 10 |
Social |
... |
... |
Jul 9 |
Social |
... |
... |
Jul 9 |
Social |
... |
... |
Jul 9 |
Forums |
... |
... |
Jul 9 |
Social |
... |
... |
Jul 8 |
Social |
... |
... |
Jul 8 |
Social |
... |
... |
Jul 7 |
Forums |
... |
... |
Jul 7 |
Forums |
... |
... |
Jul 7 |
Social |
... |
... |
Jul 7 |
Social |
... |
... |
Jul 6 |
Social |
... |
... |
Jul 6 |
Social |
... |
... |
Jul 6 |
Social |
... |
... |
Jul 6 |
Social |
... |
... |
Jul 4 |
Forums |
... |
... |
Jul 4 |
Social |
... |
... |
Jul 4 |
Social |
... |
... |
Jul 3 |
Social |
... |
... |
Jul 3 |
Social |
... |
... |
Jul 3 |
Social |
... |
... |
Jul 2 |
Social |
... |
... |
Jul 2 |
Social |
... |
... |
Jul 1 |
Forums |
... |
... |
Jul 1 |
Social |
... |
... |
Jul 1 |
Social |
... |
... |
Jun 30 |
Social |
... |
... |
Jun 30 |
Social |
... |
... |
Jun 30 |
Social |
... |
... |
Jun 29 |
Videos |
... |
... |
Jun 29 |
Social |
... |
... |
Jun 29 |
Videos |
... |
... |
Jun 29 |
Social |
... |
... |
Jun 28 |
Social |
... |
... |
Jun 28 |
Social |
... |
... |
Jun 27 |
Forums |
... |
... |
Jun 27 |
Forums |
... |
... |
Jun 27 |
Forums |
... |
... |
Jun 27 |
Forums |
... |
... |
Jun 26 |
Forums |
... |
... |
Jun 26 |
Social |
... |
... |
Jun 26 |
Social |
... |
... |
Jun 25 |
Social |
... |
... |
Jun 25 |
Social |
... |
... |
Jun 24 |
Social |
... |
... |
Jun 23 |
Forums |
... |
... |
Jun 23 |
Social |
... |
... |
Jun 23 |
Social |
... |
... |
Jun 21 |
Forums |
... |
... |
Jun 21 |
Social |
... |
... |
Jun 21 |
Social |
... |
... |
Jun 21 |
Forums |
... |
... |
Jun 21 |
Social |
... |
... |
Jun 20 |
Social |
... |
... |
Jun 20 |
Forums |
... |
... |
Jun 20 |
Forums |
... |
... |
Jun 20 |
Forums |
... |
... |
Jun 19 |
Social |
... |
... |
Jun 19 |
Social |
... |
... |
Jun 18 |
Social |
... |
... |
Jun 18 |
Social |
... |
... |
Jun 18 |
Forums |
... |
... |
Jun 16 |
Social |
... |
... |
Jun 16 |
Social |
... |
... |
Jun 14 |
Forums |
... |
... |
Jun 14 |
Social |
... |
... |
Jun 14 |
Social |
... |
... |
Jun 13 |
Social |
... |
... |
Jun 13 |
Videos |
... |
... |
Jun 13 |
Forums |
... |
... |
Jun 13 |
Social |
... |
... |
Jun 12 |
Social |
... |
... |
Jun 12 |
Social |
... |
... |
Jun 12 |
Social |
... |
... |
Jun 12 |
Social |
... |
... |
Jun 11 |
Social |
... |
... |
Jun 11 |
Social |
... |
... |
Jun 11 |
Social |
... |
... |
Jun 11 |
Social |
... |
... |
Jun 11 |
Social |
... |
... |
Jun 11 |
Social |
... |
... |
Jun 11 |
Social |
... |
... |
Jun 11 |
Social |
... |
... |
Jun 11 |
Social |
... |
... |
Jun 11 |
Social |
... |
... |
Jun 10 |
Social |
... |
... |
Jun 10 |
Social |
... |
... |
Jun 10 |
Social |
... |
... |
Jun 10 |
Social |
... |
... |
Jun 10 |
Social |
... |
... |
Jun 10 |
Social |
... |
... |
Jun 10 |
Social |
... |
... |
Jun 10 |
Social |
... |
... |
Jun 10 |
Social |
... |
... |
Jun 10 |
Social |
... |
... |
Jun 10 |
Social |
... |
... |
Jun 9 |
Social |
... |
... |
Jun 9 |
Videos |
... |
... |
Jun 9 |
Social |
... |
... |
Jun 9 |
Social |
... |
... |
Jun 9 |
Social |
... |
... |
Jun 9 |
Social |
... |
... |
Jun 9 |
Social |
... |
... |
Jun 9 |
Social |
... |
... |
Jun 9 |
Social |
... |
... |
Jun 9 |
Social |
... |
... |
Jun 8 |
Social |
... |
... |
Jun 8 |
Social |
... |
... |
Jun 8 |
Social |
... |
... |
Jun 8 |
Social |
... |
... |
Jun 8 |
Social |
... |
... |
Jun 8 |
Social |
... |
... |
Jun 8 |
Social |
... |
... |
Jun 8 |
Social |
... |
... |
Jun 8 |
Videos |
... |
... |
Jun 7 |
Forums |
... |
... |
Jun 7 |
Social |
... |
... |
Jun 7 |
Social |
... |
... |
Jun 7 |
Social |
... |
... |
Jun 7 |
Social |
... |
... |
Jun 7 |
Social |
... |
... |
Jun 7 |
Social |
... |
... |
Jun 6 |
Social |
... |
... |
Jun 6 |
Social |
... |
... |
Jun 6 |
Social |
... |
... |
Jun 6 |
Social |
... |
... |
Jun 6 |
Social |
... |
... |
Jun 6 |
Social |
... |
... |
Jun 6 |
Social |
... |
... |
Jun 6 |
Social |
... |
... |
Jun 5 |
Social |
... |
... |
Jun 5 |
Social |
... |
... |
Jun 5 |
Social |
... |
... |
Jun 5 |
Social |
... |
... |
Jun 5 |
Social |
... |
... |
Jun 5 |
Social |
... |
... |
Jun 5 |
Social |
... |
... |
Jun 5 |
Social |
... |
... |
Jun 5 |
Social |
... |
... |
Jun 5 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 4 |
Social |
... |
... |
Jun 3 |
Social |
... |
... |
Jun 3 |
Social |
... |
... |
Jun 3 |
Social |
... |
... |
Jun 3 |
Social |
... |
... |
Jun 3 |
Social |
... |
... |
Jun 3 |
Social |
... |
... |
Jun 3 |
Social |
... |
... |
Jun 3 |
Social |
... |
... |
Jun 3 |
Social |
... |
... |
Jun 3 |
Social |
... |
... |
Jun 3 |
Social |
... |
... |
Jun 3 |
Forums |
... |
... |
Jun 3 |
Social |
... |
... |
Jun 3 |
Social |
... |
... |
Jun 2 |
Social |
... |
... |
Jun 2 |
Social |
... |
... |
Jun 2 |
Social |
... |
... |
Jun 2 |
Social |
... |
... |
Jun 2 |
Social |
... |
... |
Jun 2 |
Social |
... |
... |
Jun 2 |
Social |
... |
... |
Jun 1 |
Social |
... |
... |
Jun 1 |
Social |
... |
... |
Jun 1 |
Social |
... |
... |
Jun 1 |
Social |
... |
... |
Jun 1 |
Videos |
... |
... |
Jun 1 |
Social |
... |
... |
Jun 1 |
Social |
... |
... |
Jun 1 |
Social |
... |
... |
Jun 1 |
Social |
... |
... |
Jun 1 |
Social |
... |
... |
Jun 1 |
Social |
... |
... |
Jun 1 |
Videos |
... |
... |
Jun 1 |
Social |
... |
... |
May 31 |
Social |
... |
... |
May 31 |
Social |
... |
... |
May 31 |
Social |
... |
... |
May 31 |
Social |
... |
... |
May 31 |
Social |
... |
... |
May 31 |
Social |
... |
... |
May 31 |
Social |
... |
... |
May 31 |
Social |
... |
... |
May 31 |
Social |
... |
... |
May 30 |
Social |
... |
... |
May 30 |
Social |
... |
... |
May 30 |
Social |
... |
... |
May 30 |
Social |
... |
... |
May 30 |
Social |
... |
... |
May 30 |
Social |
... |
... |
May 30 |
Social |
... |
... |
May 30 |
Social |
... |
... |
May 30 |
Social |
... |
... |
May 30 |
Forums |
... |
... |
May 30 |
Social |
... |
... |
May 30 |
Social |
... |
... |
May 29 |
Social |
... |
... |
May 29 |
Social |
... |
... |
May 29 |
Social |
... |
... |
May 29 |
Social |
... |
... |
May 29 |
Social |
... |
... |
May 29 |
Social |
... |
... |
May 29 |
Social |
... |
... |
May 29 |
Social |
... |
... |
May 29 |
Social |
... |
... |
May 29 |
Social |
... |
... |
May 29 |
Social |
... |
... |
May 28 |
Social |
... |
... |
May 28 |
Social |
... |
... |
May 28 |
Forums |
... |
... |
May 28 |
Social |
... |
... |
May 28 |
Social |
... |
... |
May 28 |
Social |
... |
... |
May 28 |
Social |
... |
... |
May 28 |
Social |
... |
... |
May 28 |
Social |
... |
... |
May 28 |
Videos |
... |
... |
May 28 |
Social |
... |
... |
May 27 |
Social |
... |
... |
May 27 |
Social |
... |
... |
May 27 |
Social |
... |
... |
May 27 |
Social |
... |
... |
May 27 |
Social |
... |
... |
May 27 |
Social |
... |
... |
May 27 |
Social |
... |
... |
May 27 |
Social |
... |
... |
May 26 |
Social |
... |
... |
May 26 |
Social |
... |
... |
May 26 |
Social |
... |
... |
May 26 |
Forums |
... |
... |
May 26 |
Forums |
... |
... |
May 26 |
Social |
... |
... |
May 26 |
Social |
... |
... |
May 25 |
Social |
... |
... |
May 25 |
Videos |
... |
... |
May 25 |
Social |
... |
... |
May 25 |
Social |
... |
... |
May 25 |
Social |
... |
... |
May 25 |
Social |
... |
... |
May 25 |
Social |
... |
... |
May 25 |
Social |
... |
... |
May 25 |
Social |
... |
... |
May 25 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Videos |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 24 |
Social |
... |
... |
May 23 |
Social |
... |
... |
May 23 |
Social |
... |
... |
May 23 |
Social |
... |
... |
May 23 |
Social |
... |
... |
May 23 |
Social |
... |
... |
May 23 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 22 |
Social |
... |
... |
May 21 |
Social |
... |
... |
May 21 |
Social |
Instagram |
Eastslope kayak classic qualifier. Good day on the water!! #kayak #kayaking #kayakfishing #fishing #spinfishing #fishing #wildernesssystemsradar135 #wildernesssystems #radar135 #wabamun #pike #pikefishing |
May 21 |
Social |
Instagram |
Beautiful reflections. #monongahelariver #wernerpaddles #wildernesssystems #wildwonderful #kayakingadventures |
May 21 |
Social |
Instagram |
Visiting our former haunts with @kristeen.young °° #anydayonthewaterisagoodday #wildernesssystems #kayaking #promisedlandstatepark |
May 21 |
Social |
Instagram |
Calm water on Lake Superior #wildernesssystems #kayaking #kayakingadventures #perceptionkayaks #bendingbranches #stohlquist #optoutside |
May 21 |
Social |
Instagram |
A bee-utiful day on the south fork. This girl crawled up my leg and we had a nice cruise while she dried off. She was eventually able to fly away:) #newriver #wildernesssystems #atpaddles #kayaking #beesplease #canthugeverybee #nc |
May 21 |
Social |
Instagram |
@Yaktribe tournament fishing! #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #helixpd #wildy #wildernesssystems |
May 21 |
Social |
Instagram |
Under a #train #trestle in a kayak. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape |
May 21 |
Social |
Instagram |
Kajakpaddling i kilsbergen ☀️. #kilsbergen #kajakpaddling #ilovekayaking #kayakgram #wildernesssystems #thisisorebro |
May 21 |
Social |
Wilderness Systems Fishing Kayaks FB |
Yeah, go ahead and fish the rapids! The 14-foot ATAK, is our smartest, most stable and performance-driven angling kayak to date. With endless storage opportunities, the ATAK lands you huge efficiency gains to prepare you for any fish at any time. Handcrafted in Greenville, SC and MADE IN THE USA. #WildyFishing #ATAK |
May 21 |
Social |
Instagram |
Rain forest kayaking, Golfo Dulce, Osa Península, Costa Rica #junglekayaking #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing |
May 21 |
Social |
Wilderness Systems Kayaks FB |
We aren't sure about you, but we aren't ready for this weekend to end! #WildernessSystemsKayaks |
May 21 |
Social |
Instagram |
Getting the new whip ready to ride!! #wildernesssystems #wildernessmen #outdoors #weekendvibes #yakattack #tarpon120 #vapelyfe #waterfun #kayaking #kayakcamping |
May 21 |
Social |
Instagram |
My new yak attack black pack has my back!!! #kayaking #kayakcamping #tarpon120 #waterfun #vapelyfe #wildernesssystems #wildernessmen #weekend #family #waterfun |
May 21 |
Social |
Instagram |
#jacksonkayak #wildernesssystems #bigriveranglersassociation |
May 21 |
Social |
Instagram |
Catfish on a rattletrap whhhhhaaaaa!!! #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy #helixpd #texas #fish |
May 21 |
Social |
Instagram |
#rainraingoaway #dontcomebackanotherday. #rainyday #rainyweek #bored #wishiwaskayaking #mn #lakes #kayaking #tarpon120 #wildernesssystems #wernerpaddles #aquabound #sunny #trees #water #life |
May 21 |
Social |
Instagram |
Getting my Sunday #timberfit workout in. #13fishing #hawgtrough #basstournament #kayakbassfishing #kayakfishing #kayakbassin #kayaking #kayakbassfishingtournament #wildernesssystemskayaks #wildernesssystems #ride115 #ride115x #blackpack #abugarcia #abugarciaforlife #13fishing #no8tackle #no8blackoutrods #puremichigan #mysterytacklebox #mysterytackleboxpro #husqvarna #chainsaws @b3astridge @mi_fowl_play @mrwranglerstar |
May 20 |
Social |
Instagram |
Nowhere I'd rather be on a sunny day . . . #kayak #kayaking #water #lake #paddle #paddlelife #summer #trees #nature #naturephoto #natureaddict #getoutside #getoutstayout #greatoutdoors @llbean @wildernesssystems |
May 20 |
Social |
Instagram |
Paddling west at sunset to get home. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape #patagonia |
May 20 |
Social |
Instagram |
° . . #kayaking #kayak #wildernesssystems #optoutside #explore #adventure #herwanderfullife #womenwhoexplore #wappingerscreek #hudsonvalley #newyork #newyorkexplored #scenicny #visitvortex |
May 20 |
Social |
Instagram |
Kayak fishing. Does it get any better?#hawgtrough #basstournament #kayakbassfishing #kayakfishing #kayakbassin #kayaking #kayakbassfishingtournament #wildernesssystemskayaks #wildernesssystems #ride115 #ride115x #blackpack #abugarcia #abugarciaforlife #13fishing #no8tackle #no8blackoutrods #puremichigan #mysterytacklebox #mysterytackleboxpro #katsmidwest #fishkats @b3astridge @mi_fowl_play @mi_lip_rippers @mikeiaconelli @flukemaster @kayakbassfishing |
May 20 |
Social |
Instagram |
This bald eagle was flying above the St Joseph river as I was kayaking. I paddled upriver until I found where he had perched. #baldeagle #bald #eagle #eagles #raptor #photooftheday #kayaking #kayak #kayakphotography #talons #hunting #birdofprey #nikon #nikond810 #nikkor #nikkor70_200mm #staredown #eyes #nature #wildlife #wildernesssystems |
May 20 |
Social |
Instagram |
Don't have the time to #portage Now but I'd like to see how much further I could go. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape |
May 20 |
Social |
Wilderness Systems Fishing Kayaks FB |
We hope your weekend includes this! #Wildyfishing |
May 20 |
Social |
Instagram |
I think this creek needs to be explored. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape |
May 20 |
Social |
Instagram |
Getting in early session in before heading to the shop. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape |
May 20 |
Social |
Wilderness Systems Kayaks FB |
You weren't born to just pay bills and die! Life's an adventure, LIVE IT. #WildernessSystemsKayaks |
May 20 |
Social |
Instagram |
Follow your dreams!!! Last summer at Steamboat Rock State Park, Wa. #nature #followyourdreams #gofsr #kayaking #kayak #climbing #hiking #ipadventures #wildernesssystems #canon |
May 20 |
Social |
Instagram |
First day out on the kayak this season #kayak #kayaking #fishing #wildernesssystems |
May 20 |
Social |
Instagram |
First day out this season #kayak #kayaking #wildernesssystems #tarpon120 #fishing #kayakfishing |
May 20 |
Social |
Instagram |
Summer is here and that means it's time to do some 'yakin! We got you covered for boat sales and rentals all summer long. Come see us and get out on the water! #kayakszn #jacksonkayak #wildernesssystems #perceptionkayaks #daggerkayaks #kayakfishing |
May 20 |
Social |
Instagram |
Paddle pup...ready for adventure! • • • • • • • • • #adventurepups #adventurepup #adventures #adventure #explore #paddle #doggypaddle #kayaking #wildernesssystems #hobie #astraldesigns #blacklab #blacklabpuppy #labpuppy #labradorretriever #labsofinstagram #rescuedog #trainingday #staywild |
May 20 |
Social |
Instagram |
When your in the mood for a little #slurpree @b3astridge @mi_fowl_play @mi_lip_rippers @smart_blade_works @rad_willie @alf_with_an_a #slurpee#hawgtrough #basstournament #kayakbassfishing #kayakfishing #kayakbassin #kayaking #kayakbassfishingtournament #wildernesssystemskayaks #wildernesssystems #ride115 #ride115x #blackpack #abugarcia #abugarciaforlife #13fishing #no8tackle #no8blackoutrods #puremichigan #mysterytacklebox #mysterytackleboxpro #katsmidwest #fishkats #hobiekayakfishing #hobieproangler14 |
May 20 |
Social |
Instagram |
If you need me, I'll be here...for as long as I possibly can. #kayaking #paddle #wildernesssystems #lake #centralcalifornia #serenity |
May 20 |
Social |
Instagram |
#river #art . . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape |
May 19 |
Social |
Instagram |
Not too bad tonight @nrsfishing @paddleva @lews_fishing @lowrancefishing @wildyfishing @wildernesssystems #kayaking #kayakinglife #kayakfishing #kayakbassfishing #lifeofadventure #lifeoutdoors #lifeoutside #kayakfishingfrenzy |
May 19 |
Social |
Instagram |
. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #tempest165 #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #kayaklyfe #kayakgram #paddlingmixtape |
May 19 |
Social |
Instagram |
#tbt the original #adventurepup, Gryffin, showing the pups how it's done. • • • • • • • • • #adventure #adventures #adventurepups #kayaking #adventureswithdogs #wilderness #wildernesssystems #safetyfirst #rescuedog #rescue #rescuepups #waterdog #duckdog #explore #travel #nature #getoutside #optoutside #lakelife #doglife #paddle #doggypaddle #staywild #wild #lakelanier |
May 19 |
Social |
Instagram |
Loved the leaning trees though this stretch. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #tempest165 #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #kayaklyfe #kayakgram #paddlingmixtape |
May 19 |
Social |
Wilderness Systems Fishing Kayaks FB |
Please take our survery and win a $50 credit towards harmonygear.com! --->https://www.surveymonkey.com/r/TPRZ655 Help us make the best spray skirts on the market! Only applicable to paddlers who have experience with sit inside kayaks and those that have experience with spray skirts. |
May 19 |
Social |
Instagram |
It looks like an eye was carved into the top of this rock ledge . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #explore #kayaklyfe #kayakgram #paddlingmixtape |
May 19 |
Social |
Instagram |
Adventurer in training #wildernesssystems #kayaking #kayak #yak #newengland #newhampshire #shelovedit #swimming #paddle #water #watersports #beactive |
May 19 |
Social |
Instagram |
Quiet morning on the #tennesseeriver. An overcast day on the #river is better than any day at work! - - - - - - #optoutside #visitknoxville #betterthanwork #tennessee #betteroutside #ousideisfree #tennesseeoutdoors #refection #kayak #kayaking #bridges #wildernesssystems #samsunggalaxys7 #phonephotography #ig_nature #opticalillusion |
May 19 |
Social |
Instagram |
Kayak/bag/camera set up. Simple backpack-cut the straps and sewed on clips. Added clips to deck. Much cheaper and works better. Bladder in bag means no more bottle rolling around. Modded a car/cell phone holder as a camera mound. Out wide to get less boat in the pic, but still easy to reach. Waterproof housing and quick release. This is a Polaroid cube. Every bit as good as GoPro, 1/4 the price... #kayak #kayaking #adventure #camping #mendocino #fortbragg #pointarena @wildernesssystems @wernerpaddles |
May 19 |
Social |
Instagram |
Rollin'! Two Wilderness ATAK 140's following us to the YakAttack tournament. #wildyfishing #wernerpaddles #wildernesssystems #yakattack #becausewefish #paddle4fish #paddleva |
May 18 |
Social |
Instagram |
What a gorgeous evening to be out on the water! #kayak #kayaking #wildernesssystems #blackcreek #newyork #visitvortex #optoutside #scenicny #newyorkexplored #explore #adventure #womenwhoexplore #herwanderfullife #goeast #nofilter #spring |
May 18 |
Social |
Instagram |
Wilderness Systems Zephyr 155 y 160. Dos tamaños para acomodarse a kayakistas de distintos portes. Con un cockpit más grande, comodidad no falta en el Zephyr, es muy veloz, maniobrable, ágil y responde rápidamente cada movimiento que intentes. Wilderness está en nuestra página, elige el tuyo: www.riverslakesoceans.com #travesia #kayakdetravesia #seakayak #kayaking #patagoniachilena #patagonia #chile #argentina #rlo #riverslakesoceans |
May 18 |
Social |
Instagram |
My Greenland paddle. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #tempest165 #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #kayaklyfe #kayakgram #paddlingmixtape |
May 18 |
Social |
Wilderness Systems Kayaks FB |
Little video demonstrating just how stable Wilderness Systems Kayaks are!! 📷: Kevin Hofer |
May 18 |
Social |
Instagram |
Guess we're a two boat family now. #kayak #paddling #ramakkos_sfa #kayaking #wildernesssystems #wildysystems #pungo140 #commander140 #hisandhers |
May 18 |
Social |
Instagram |
Stumbled across this last night. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #tempest165 #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #kayaklyfe #kayakgram #paddlingmixtape |
May 18 |
Social |
Wilderness Systems Fishing Kayaks FB |
The smile says it all! Who really cares how big the fish are as long as your are out fishing! :) #WildyFishing Photo by Josh Brightman |
May 18 |
Social |
Instagram |
We have new Wilderness Systems kayak packages available in store! Get a free spray skirt and paddle with your purchase. #pnw #seattle #westseattle #kayak #kayaklife #explore #kayaking #kayaker #kayakingadventures #seakayaking #kayakexplorer |
May 18 |
Videos |
Youtube |
Fly Fishing for Redfish and Sightcasting Redfish From a Kayak - Wilderness Systems Radar 135 |
May 18 |
Forums |
/r/Kayaking |
Fast sit-on-top for southern USA lake paddling: suggestions? |
May 18 |
Social |
Instagram |
New boat day! Thank you Wild River Outfitters for a great deal on a great used kayak! #wildriveroutfittersvb #kayaking #newboatday #wildernesssystems #focus155 |
May 17 |
Social |
Instagram |
Her first time kayaking in ten years! #paddle #kayaking #kayak #yak #newengland #newhampshire #wildernesssystems #perception #water #watersports |
May 17 |
Social |
Instagram |
Always a good time fishing with friends ... even if your @team13fishing rod and reels drops in #cayugalake ... #nykbf #fingerlakes #fuzzyguppies #kayakbassfishing #iloveny #teamfuzzyguppies #kayakfishing #fishNY ... and even if they paddle a #wildernesssystems ... lol #jacksonkayak #jacksonkayak4eva |
May 17 |
Social |
Instagram |
Beautiful day on the water today. #kayakfishing #kayakbassfishing #tkaa #bassfishing #anglerapproved #rippinlips #largemouthbass #tugisthedrug #wildernesssystems #paddleva #vabeach #wernerpaddles #yaktribe #pigpatrol #catchandrelease |
May 17 |
Social |
Instagram |
There was ice in this lake two days ago. Today? 70° and time to get the boat out. Summer is here! #rei #reiemployee #optoutside #coop #alaska #adventure #alaskalife #kayak #wildernesssystems #pungo #kokatat |
May 17 |
News |
Rod Swan |
Surf Kayaks for wave riding and surfing - Custom made Mega Surf Kayaks |
May 17 |
Social |
Instagram |
Boat control. #scullingbrace #lowbrace #wildernesssystems #kayak #kayaking |
May 17 |
Social |
Instagram |
That feeling when it's still the work day but you know you'll be in a kayak on the water after work. . . . . #kayak #kayaking #longboat #kayakadventures #kayaknc #ncoutdoors #paddle #paddling #wildernesssystems #tempest165 #greenland #greenlandpaddle #paddlesports #water #watersports #onthewater #outside #outdoors #adventure #kayaklyfe #kayakgram #paddlingmixtape |
May 16 |
Social |
Instagram |
Kayaking Priest Lake!!! #godscountry #kayaking #kayakingadventures #kayak #pnw #ipadventures #inmanphotography #pnwonderland #pnwcollective #paddle #priestlake #mylife #wildernesssystems |
May 16 |
Social |
Instagram |
Caught half dozen or more this size Saturday during the tournament. Only rememberd once to record video. New link in bio for a catch, measure release a #dink! @mi_lip_rippers @mi_fowl_play @b3astridge @flukemaster @kayakbassfishing #hawgtrough #katsmidwest #basstournament #kayakbassfishing #kayakfishing #kayakbassin #kayaking #kayakbassfishingtournament #wildernesssystemskayaks #wildernesssystems #ride115 #ride115x #blackpack #abugarcia #abugarciaforlife #13fishing #no8tackle #no8blackoutrods #puremichigan #mysterytacklebox #mysterytackleboxpro #katsmidwest #fishkats |
May 16 |
Social |
Instagram |
New YouTube video in the making. DIY deck mat for the Radar135 #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy #helixpd #diy |
May 16 |
Forums |
NorCal Kayak Anglers |
I have two kayaks for sale Wilderness Systems The Ride and Cobra Fish N Game |
May 16 |
Social |
Instagram |
Time for a trip to Sullivan Lake, Wa!!! Get out there!!! #wildernesssystems #mylife #paddle #kayak #kayaking #kayakingadventures #ipadventures #lakelife #lake #camping #pnw #pnwlife #pnwonderland #pnwcollective |
May 16 |
Social |
Wilderness Systems Fishing Kayaks FB |
Little video demonstrating just how stable Wilderness Systems Kayaks are!! 📷: Kevin Hofer |
May 16 |
Social |
Wilderness Systems Kayaks FB |
Sometimes all you need is a little water, a kayak and a sunset! Middle Concho River in San Angelo TX. #nofilter #WildernessSystemsKayaks #kayaking 📷: Kathy Walker |
May 16 |
Social |
Instagram |
Had an awesome first time on Lake St. Clair yesterday with @clyde.ickes in the kayaks. Absolutely LOVE the performance of my new @wildernesssystems Ride 115, especially on the big water. Caught 7 different species too! Huge thanks to @jrscott26427 for all his advice and help! #wildernesssystems #kayakfishing #puremichigan #northernpike #smallmouth #smallie #largemouth #fishing #kayaking #stcroix #hukfishing #shimano #stclair #lakestclair |
May 16 |
Social |
Instagram |
Bracing. #wildernesssystems #wildernesssystemskayaks #kayaking |
May 16 |
Social |
Instagram |
Paddle paddle paddle #kayaking #yak #kayak #wildernesssystems #perception #newengland #newhampshire #goutside #livelife |
May 16 |
Videos |
Youtube |
Kayak Fly Fishing in the Wilderness Systems Radar 135 Helix PD Marsh Trip Alligator Gar on Fly |
May 15 |
Videos |
Youtube |
Sea Kayak Surf - Santa Clara, Buenos Aires, Argentina - 7BSK Seven Boys Sea Kayak |
May 15 |
Social |
Wilderness Systems Fishing Kayaks FB |
Ever have one of those weekends you wish would never end? #Wildyfishing 📷: Jared Esley |
May 15 |
Social |
Instagram |
Got her wired up and operational. @lowrancefishing makes some good electronics. This thing has been dropped, submerged and been in some of the worse weather mother nature has to throw at it and it keeps on ticking away. Great stuff to use. #kayakfishing #kayakbassfishing #kayaking #kayak #wildernesssystems #wildyfishing #atak140 #fishing #fishfinder #kayakrigging #lowrance |
May 15 |
Social |
Instagram |
Although I didn't place, it was a good day of fishing, looking forward to the next tournament!#kayakbassfishing #kayakfishing #kayakbassin #kayaking #kayakbassfishingtournament #wildernesssystemskayaks #wildernesssystems #ride115 #ride115x #blackpack #abugarcia #abugarciaforlife #13fishing #no8tackle #no8blackoutrods #puremichigan @mi_lip_rippers @mi_fowl_play @b3astridge @flukemaster @kayakbassfishing #mysterytacklebox #mysterytackleboxpro #katsmidwest |
May 15 |
Forums |
NorCal Kayak Anglers |
Re: Wilderness Systems Lithium Battery-new thread |
May 15 |
Social |
Instagram |
Thanks @REI for helping to put in this kayak ramp to make it easier to get down to the water! ❤️ #dogslife #dogapproved #happylife #kayak #kayakingdog #kayakingwithdogs #lovemydog #enjoylife #lifeisgood #liveyourlife #lifeisbetterwithadog #adventuredog #adventureawaits #kayaking #pungo120 #wildernesssystems #beautifulday #optoutside #alifeoutdoorsisalifewelllived #forceofnature #unitedoutside #blueskies #puremichigan #adventure #lifeisbeautiful #lovethis #loveyourlife #authentic #stewardship #rei |
May 15 |
Social |
Instagram |
Radar 135 with DIY deckmat. #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildy #wildernesssystems #helixpd #radar #radar135 @wildyfishing |
May 15 |
Social |
Instagram |
Thank you @nextadventure for the @wildernesssystems A.T.A.K 140. I can't wait to get this beast on the water. #wildernesssystems #kayaking #kayakfishing #kayak #lake |
May 14 |
Social |
Instagram |
Still working on it. Wilderness Systems Radar135 deck mat. #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #helixpd #wildernesssystems #radar #radar135 |
May 14 |
Social |
Instagram |
Got the fish finder installed in the removable pod for the kayak tonight. Just have to get a new battery and finish the inside. Made an adapter block for the bottom of the scupper bracket from the other boat since I didn't have the original bracket to install the transducer. Everything is nice and solid. @wildyfishing #kayakfishing #kayakbassfishing #kayaking #kayak #wildernesssystems #wildyfishing #atak140 #fishing #fishfinder #kayakrigging #lowrance |
May 14 |
Social |
Instagram |
Very happy with this setup on my ATAK 140 Makes setting up to go fishing a lot better now. My last boat I needed a separate battery box to use. @wildyfishing #kayakfishing #kayakbassfishing #kayaking #kayak #wildernesssystems #wildyfishing #atak140 #fishing #fishfinder #kayakrigging #lowrance |
May 14 |
Social |
Instagram |
Finished! #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #radar135 #radar #wildernesssystems #helixpd #wildy |
May 14 |
Social |
Instagram |
Mothers comes in all shapes and sizes. Happy Mother's Day to all the great Women in my life. #mothersday #kayaking #paddleseason @boatingindc #keybridge #potomacriver @wildernesssystems #babygeese #rooseveltisland |
May 14 |
Social |
Instagram |
We have a great time kayaking 16 miles on the Yadkin River today. We saw around 65 species of birds too. #winstonsalem #yadkinriver #birding #wildernesssystems #riteintherain #garmin #kayaking #swarovskioptik |
May 14 |
Social |
Instagram |
So many awesome photos from last year surfacing! #bvdboatparade @bayouvermiliondistrict #wildernesssystems #reptheriver #lafayettestrong #acadiana #vermilionriver #kayaking #cannonpaddles #beachball #louisiana |
May 14 |
Social |
Wilderness Systems Kayaks FB |
To all the awesome moms out there today is your day! HAPPY MOTHER'S DAY. |
May 14 |
Social |
Instagram |
Enjoying a beautiful day on the water with my lady, @annelyomega . The wind is doing a not cooperating, but still a good time. #kayaking #creek #sundayfunday #spring #saltlife #optoutside #wildernesssystems #pungo120 #perceptionsport #swiftwater #homesweethome |
May 14 |
Social |
Wilderness Systems Fishing Kayaks FB |
To all the amazing moms out there, HAPPY MOTHER'S DAY! |
May 13 |
Social |
Instagram |
Whooooo wants a kayak??? Selling mine! Great condition! Wilderness Systems Pungo 120. Includes paddle and seat cover. $450 #vt #ilovermont #nature #beauty #kayaking #getoutside #summervibes #youknowyouwanna |
May 13 |
Social |
Instagram |
#wildernesssystems #kayaking #foxriver #summerfun #letsgooutside |
May 13 |
Social |
Instagram |
Part one of the deck mat project on the way. #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy #radar135 #radar |
May 13 |
Social |
Instagram |
We got new kayaks! Guess which one's mine! #kayaking #wildernesssystems #nofilter |
May 13 |
Social |
Instagram |
#demo day #belleisle #paddlehappy #nativewatercraft #hurricanekayaks #wildernesssystems #wernerpaddles #northshore #valley |
May 13 |
Social |
Instagram |
Ready to get out on the water! Grey clouds have all gone away @wildernesssystems @wildyfishing @lowrancefishing @lews_fishing @uglystik @paddleva @nrsfishing #kayakfishing #kayaktournament #kayakbassfishing #kayakfishingfrenzy #weather #bluesky #kayaking #kayakingtrip #kayakinglife #kayakingadventure |
May 13 |
Social |
Wilderness Systems Fishing Kayaks FB |
We hope your weekend includes some of this! #Wildyfishing 📷: Scott Schrader |
May 13 |
Social |
Instagram |
It's not a great day to go paddling, but it's a perfect day to gear up for your next trip. We have aisles of accessories to make your trip a bit easier. . . . . . . . #canoecountryfl #ccofl #wildernesssystems #harmony #stpete #tampabay #florida #kayak #kayaking #paddlefishing #kayakfishing #angler |
May 13 |
Social |
Instagram |
Finally snuck in a paddle..., . . . . #floridakeys #islamorada #flyfishing #girlswhofish #kayakfishing #kayaking #wildernesssystems #tarpon100 |
May 13 |
Social |
Wilderness Systems Kayaks FB |
Wilderness Systems Kayaks are so comfortable you will have to fight your dog for it! :) #WildernessSystemsKayaks |
May 13 |
Social |
Instagram |
Kevin got no White Bass bites at Lake Nacimiento but had some fun on the Wilderness Systems Thresher‼️° #lakenacimiento #lakeoroville #clearlake #kayaking #kayakfishing #funinthesun #wildernesssystems #nowakezone |
May 13 |
Social |
Instagram |
That's a wrap for today's Demo Day! If you missed us today, be sure to check us out again on June 3rd! Same bat time, same bat channel.... #demoday #hobiefishing #kayakfishing #welovemidcity #nativewatercraft #jacksonkayak #wildernesssystems #perceptionkayaks |
May 12 |
Social |
Instagram |
First time getting out and fishing in my new wilderness systems radar 135, few trout in the net. All and all a good night on the water. ##radar135 #flyfishingaddict #flyfishalberta #flyfishing #flyfishingalberta #kayak #kayakfishing #kayaking #wildernesssystemsradar135 #wildernesssystems @wildyfishing @wildernesssystems |
May 12 |
Social |
Instagram |
Weekend project: deck mat the Radar 135! #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildy #wildernesssystems #radar #radar135 |
May 12 |
Social |
Instagram |
Nice skies tonight! I wish it was a little warmer though!#bassfishing #fishing #kayakfishing #kayakangler #kayaking #kayak #wildernesssystems #sunset #sunsets #sun #sky #skyporn #clouds #cloudporn #dusk #nature #thegreatoutdoors #picoftheday #pictureoftheday #photography #lake #lakelife |
May 12 |
Forums |
/r/Kayaking |
Have a bunch of questions about buying my first kayak. Budget around $1k including the essentials. I'd appreciate any help! |
May 12 |
Forums |
NorCal Kayak Anglers |
Re: Looking for ideas |
May 12 |
Social |
Instagram |
Kayak is ready to rock for this weekend! Also check out my latest YouTube walk through on how I have it set up and rigged for tournament fishing! Link in bio! #kayakbassfishing #kayakfishing #kayakbassin #kayaking #kayakbassfishingtournament #wildernesssystemskayaks #wildernesssystems #ride115 #ride115x #blackpack #abugarcia #abugarciaforlife #13fishing #no8tackle #no8blackoutrods #puremichigan @mi_lip_rippers @mi_fowl_play @b3astridge @flukemaster @kayakbassfishing |
May 11 |
Social |
Instagram |
This is a pretty great way to spend the evening when the fish aren't biting #kayaking #kayak #wildernesssystems #uneek #keenuneek #keen |
May 11 |
Social |
Instagram |
Couple bass tonight, unfortunately I lost more than I caught! #bass #bassfishing #largemouthbass #largemouth #catchoftheday #catchandrelease #cantstopwontstop #kayakangler #kayakfishing #kayaking #lake #lakelife #freshwaterfishing #freshwater #fish #lifestyle #selfie #myaddiction #nature #thetugisthedrug #thegreatoutdoors #bassmaster #wildernesssystems #rippinlips #bentrods #fishinglife |
May 11 |
Social |
Wilderness Systems Kayaks FB |
In the end we only regret the things we DIDN'T do! #WildernessSystemsKayaks |
May 11 |
Social |
Wilderness Systems Fishing Kayaks FB |
I got 99 problems and fishing from my kayak solves them all!! #Wildyfishing |
May 11 |
Social |
Instagram |
Open ocean kayaking, Golfo Dulce, Osa Península, Costa Rica #junglekayaking #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing |
May 10 |
Social |
Instagram |
Awesome boat! Can't wait to get this boat out and yank some lips! @wildyfishing @wildernesssystems #wilderness #outdoors #wildernessculture #kayak #kayaking #greatoutdoors #kayakfishing #fishing |
May 10 |
Social |
Instagram |
Went to get my #pungo and found a Carolina wren nest. One very mad mother and 2 chicks. #wildernesssystems #pungo100 #kayaking |
May 10 |
Social |
Instagram |
My new toy ° #tarpon120 #wildernesssystems #kayaking #anglerlife #fishing |
May 10 |
Social |
Wilderness Systems Fishing Kayaks FB |
Take the survey now and help us help you!! We are looking to make a unique line of dry bags that our fans will love! Please take a minute and take this quick survey by CLICKING HERE ---> https://www.surveymonkey.com/r/GYZ5HNJ |
May 10 |
Social |
Instagram |
Absolutely gorgeous day for kayaking! ❤️ #dogslife #dogapproved #happylife #kayak #kayakingdog #kayakingwithdogs #lovemydog #enjoylife #lifeisgood #liveyourlife #lifeisbetterwithadog #adventuredog #adventureawaits #kayaking #pungo120 #wildernesssystems #beautifulday #optoutside #alifeoutdoorsisalifewelllived #forceofnature #unitedoutside #blueskies #puremichigan #adventure #lifeisbeautiful #lovethis #loveyourlife #authentic |
May 10 |
Social |
Instagram |
Completely in my element spending hours today on #LakeGrapevine practicing and perfecting strokes with my new mentor for adventures coming my way! °❤️#spring2017 #wildernesssystems #outdoorwomen #definefeminine #wernerpaddles |
May 9 |
Forums |
NorCal Kayak Anglers |
FNG Here |
May 9 |
Social |
Instagram |
Family day... just me and mom dukes. #harpeth #oldtown #wildernesssystems #kayaking #hiphop #jamband #alllove #nevercouldbeanythingelse #erryweek #getoutside #icouldcry #sun #science #hashtag #selfie #myface #youknow #betterknowit |
May 9 |
Social |
Instagram |
First trip of the summer #seakayaking #kayaking #glengarriff #glengarriffharbour #bantrybay #cork #ireland #instaireland #inspireland_ #irishpassion #wanderireland #summer #wildernesssystems #perceptionkayaks |
May 9 |
Social |
Instagram |
This Saturday, join us on Bayou St. John for a free kayak demo! We'll be bringing out all your favorite models from brands like Hobie, Jackson Kayak, Native Watercraft, Wilderness Systems and Perception. 10am to 3pm, come try before you buy! #kayakdemo #demoday #hobiefishing #jacksonkayak #wildernesssystems #kayak #kayakfishing #welovemidcity #bayoustjohn |
May 9 |
Social |
Instagram |
Looking for a tandem boat for your family? We have 3 for sale - Wilderness Systems Pamlico with rudder (x2) and Perception sit-on top Tribe. They are cleaned up and ready to go home with you! Message us or give us a call for pricing. #riverlife #kayaking #paddlefxbg #rappahannock |
May 9 |
Social |
Wilderness Systems Kayaks FB |
Could use one every day!! |
May 9 |
Social |
Instagram |
It was chilly, water was up and muddy but we still had a great time. Great way to spend your anniversary thanks to my awesome wife ° #kayaking #fishing #kayakfishing #wildernesssystems #ride115 #tarpon135t #ride115xmaxangler #shimano #shimanoreels #shimanosustain #gloomis #gloomisnrx #gloomisrods #gloomisfishing #virginia #virginiarivers #virginiafishing #newriver #pembroke |
May 9 |
Social |
Instagram |
I couldn't ask for a better wife, loving and beautiful and takes me fishing and kayaking on our 18th anniversary. I love you @skylar2caleb Happy Anniversary °#bestwifeever #loveyou #18thanniversary #kayaking #kayakfishing #fishing #wildernesssystems #shimano #shimanoreels #shimanosustain #gloomis #gloomisnrx #gloomisrods #newriver #pembroke |
May 9 |
Social |
Instagram |
So this was my parents first time in a kayak and I threw the right on the New River lol probably not the smartest move I ever made but they did great. #pembroke #newriver #virginiarivers #wildernesssystems #tarpon135t #kayakfishing #kayaking #shimano #shimanoreels #garyyamamoto #yamamotobaits |
May 9 |
Social |
Wilderness Systems Fishing Kayaks FB |
Show us a pic of your fish!! #Wildyfishing |
May 9 |
Social |
Instagram |
Kayaking with the Bugs! #doggles #harpethriver #kayaking #itsadogslife #rescuedog #rescuedogsofinstagram #wildernesssystems #puppymillrescue ##ventureready #cumberlandtransit #cumberlandtransitambassador #affenpinscher #flyfishingdog |
May 8 |
Social |
Instagram |
Fresh batch ready for skirts. @mi_lip_rippers @mi_fowl_play @b3astridge @jleohuntfish @smart_blade_works #fishing #diyfishinglures #abugarciaforlife #13fishing #wildernesssystemskayaks #wildernesssystems #ride115 #puremichigan #kayaking #kayakbassin #kayakfishing #kayakbassfishingtournament |
May 8 |
Social |
Instagram |
And then this happened #sunset #bluesky #skylover #skyporn #sundayfunday #iphone #summer #paddle #kayaking #yaklife #oklahoma @canthandletheploof #freshwater #wernerpaddles #wildernesssystems #perceptionkayaks |
May 8 |
Social |
Instagram |
Didn't catch a single fish° however I do love this woman. #lowtide #kayaking #wildernesssystems #tarpon140 #cuda14 |
May 8 |
Social |
Instagram |
Our boat demo is this Wednesday! We'll be out at River Park North from 4p-7p with our demo fleet ready to get you on the water. This is the perfect opportunity to test paddle that kayak you've had your eye on! See link in bio for more details. #hobiekayak #wildernesssystems #jacksonkayak #hurricanekayak #nucanoe #feelfreekayak #boatdemo #kayak #canoe |
May 8 |
Social |
Instagram |
#jetlife #lake #wildernesssystems #wernerpaddles #freshwater #lake #paddle #yaklife #sundayfunday #skylover #sunset #bluesky #orangesky #skyporn #iphone #nature @canthandletheploof #birdwatching |
May 7 |
Social |
Instagram |
Dragged my daughter on the lake for a little bit. Just 1 bass a few pickerel. Tomm is another day! #bass #bassfishing #largemouth #largemouthbass #catchoftheday #catchandrelease #cantstopwontstop #lifestyle #myaddiction #kayakangler #kayakfishing #kayaking #kayak #lake #lakelife #pictureoftheday #selfie #fishon #rippinlips #wildernesssystems #baitcaster #lunkerchasers #spring #thetugisthedrug #thegreatoutdoors #nature |
May 7 |
Social |
Instagram |
Want free fishing gear? ••• Click on the link in my bio and download the NPS (National Pro Staff) App. By using my link, you and I will both gain points that can be used to get FREE fishing gear. ••• #pickerel #bassfish #bass #summer #wildernesssystemkayaks #bassfishing #abugarcia #fishing #berkley #catchandrelease #wildernesssystems #largemouthbass #free #kayaklife #l4l #nature #angler #kayak #fresh #follow4follow #like4like #freshlife #freshwaterfishing #fishagram #edit #kayakadventures #kayaking #kayakangler |
May 7 |
Social |
Instagram |
So what is Kayak Fishing Frenzy #kayakfishing #kayakbassfishing #kayak #wildernesssystems #jacksonkayak #oldtownkayak #kayakfishingfrenzy #kayaktournament #kayaktournamentangler @wildernesssystems @oldtowncanoes @jackson.kayak @advancedelements @hobiecatcompany |
May 7 |
Videos |
Youtube |
REVIEW: Wilderness Systems Tsunami 140 Kayak |
May 7 |
Forums |
/r/Kayaking |
Looking to upgrade to a fiberglass boat.. any suggestions? |
May 7 |
Social |
Instagram |
A slow bite today as expected, but still landed 3 fish. #bass #bassfishing #largemouth #pike #largemouthbass #largemouthbassfishing #catchoftheday #catchandrelease #cantstopwontstop #lake #lakelife #kayakangler #kayakfishing #kayaking #kayak #wildernesssystems #thegreatoutdoors #thetugisthedrug #spring #selfie #picoftheday #pictureoftheday #nature |
May 7 |
Social |
Instagram |
Newest addition to the fleet of toys. I can't wait to get some paddle time in. @wildernesssystems #pungo120 #pungo #kayak #kayaking #md #paddle #wildernesssystems |
May 7 |
Social |
Instagram |
Had the seat on my @wildernesssystems kayak too far forward and popped it out of the groove. There was no way I was going I to the water though. #kayak #kayaking #oklahomariver #oops |
May 7 |
Social |
Wilderness Systems Kayaks FB |
That's funny!! |
May 7 |
Social |
Wilderness Systems Fishing Kayaks FB |
We hope your weekend included some of this! #Wildyfishing |
May 6 |
Social |
Instagram |
Zman always clutch! This sealed it. . . . . #zman #wildernesssystems #kayakfishing #inshore #hckac #hckaclub #tournament #windy #hardcore #fish #snook #kayaking #yakangler #flogrown #procure #saltwaterexperience #flatsclass @zmanfishingproducts @wildyfishing |
May 6 |
Social |
Instagram |
Bold women... Big hearts. Heroes on the Water event. #cumberlandtransitambassador #cumberlandtransit #ventureready #volunteering #womenpower #hook1outfitters #flyfishingwomen #womenempowerment #strongwomen #strongwoman #kayaking #wildernesssystems #friends |
May 6 |
Social |
Wilderness Systems Fishing Kayaks FB |
Wilderness Systems Kayaks the most COMFORTABLE kayak you will ever own. They're so comfortable you will have to fight your dog for it! #Wildyfishing |
May 6 |
Social |
Wilderness Systems Kayaks FB |
People LOVE the COMFORT and STABILITY of Wilderness Systems Kayaks but you know what else they love? All our very cool colors! Show us a pic of your Wilderness Systems Kayaks. |
May 6 |
Social |
Instagram |
Wishing we were #yakin #wildernesssystems #delawarewatergap #coolersandbeer #nobearsonthewater #kayaking #fishing #saltlife #exceptnosalt |
May 6 |
Social |
Instagram |
Kesän ensimmäinen #melonta #kesä #kajakki #joki #meri #silta #porvoo #visitporvoo #suomi #mahtipäivä #kaislikossasuhisee #sininentaivas. First #kayak #wildernesssystems #kayaking #trip this #summer #river #sea #bridge #sunshine #sun #greatfeeling #finland @suutarinenj |
May 6 |
Social |
Instagram |
Taking these #badboys on the lake for the first time this year. #water will be #cold but let's plan on not tipping over. Loving this #gorgeous #weather!! #keepitup #mn! #kayaking #kayak #wildernesssystems #tarpon120 #madisonlake #keepitsimple #thule #aquabound #wernerpaddles #subaru #crosstrek #life |
May 5 |
Videos |
Youtube |
Pre-Spawn Kayak Bass Fishing |
May 5 |
Social |
Instagram |
Nothing like a great day out on the water. #wildernesssystems #reiyonkers #reiemployee #nofilter #ny #kayaking |
May 5 |
Social |
Instagram |
@sydsewell7792 with an absolute toad out of her Yak! -----------------------------------------------------------DM me or #explorekayakfishing for a feature! #kayak #kayaking #kayakfishing #kayakbassfishing #largemouthbass #LMB #yakaddicts #jacksonkayak #wildernesssystems #hobie #fishing #freshwaterfishing #saltwaterfishing #catfishing #crappiefishing #creekfishing #creeklife #riverfishing #riverlife #like #follow |
May 5 |
Social |
Instagram |
@carmenskayaks 239-333-7332 #novice #kayak #fisherman #fisherwoman #kayaking #kayakguidedtours #kayakfishingguide #kayakfishing #redfish #snook #sheepshead #jackcrevalle #fishinglessons #wildernesssystems #Penn #shimano #guidelife |
May 4 |
Social |
Instagram |
Rainforest kayaking, Golfo Dulce, Osa Península, Costa Rica #junglekayaking #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing |
May 4 |
Social |
Instagram |
Got a few new #wildernesssystems boats for our Bandon/Coos and Rogue Fleets. Oregon's south coast is holding massive paddling opportunities! #thepeoplescoast #traveloregon #SCT #kayaking |
May 4 |
Social |
Instagram |
Working on plans for the weekend yet? Don't forget we have some of the best rental rates in town. No better way to enjoy the weekend than on the water! . . . . . . . #canoecountryfl #ccofl #rental #kayak #kayaking #paddlinf #weekend #florida #stpete #tampabay #fishingkayak #wildernesssystems #perceptionkayaks |
May 4 |
Social |
Instagram |
A hoss of a catfish drug in buy @tommyblommy.. Pic sent in by @bashfab! ----------------------------------------- DM me or #explorekayakfishing for a feature! #kayak #kayakfishing #kayaking #yakattack #yakaddicts #jacksonkayak #wildernesssystems #fishing #bassfishing #catfishing #crappiefishing #outdoors #largemouthbass #LMB #creekfishing #creeklife #riverfishing #riverlife #freshwaterfishing #saltwaterfishing #savetheskinnywater #follow #like |
May 4 |
Social |
Instagram |
We are one week away from the Triad Boat Demo! Come try out some boats you've been curious about next Thursday at Oak Hollow lake from 4pm-7pm. No reservations necessary, just show up. See you there! #boatdemo #hobiekayak #jacksonkayak #kayakfishing #wsnc #northcarolina #nctriad #wildernesssystems #perceptionkayaks #northcarolina #kayaking #oakhollow |
May 4 |
Social |
Instagram |
This Saturday, May 6th - at the Vermilionville pond in Lafayette, try new models from Jackson, Wilderness Systems, Native Watercraft, NuCanoe, Bote Board and others. Come try the Wilderness Systems 'Radar' or the Jackson 'Mayfly' and experience the full line up of 2017 Hobie kayaks featuring the new Mirage Drive 180! #kayakdemoday #inspiringhorizons #hobiefishing #jacksonkayak #wildernesssystems #nativewatercraft |
May 3 |
Videos |
Youtube |
Wilderness Systems Fishing Kayak Helix Pedal Drive First Impressions for Kayak Fishing |
May 3 |
Social |
Instagram |
#exploregeorgia #northgatreks #salocoalake #kayak #kayaking #exploregordon #calhounga #lakelife #wildernessculture #wildernesssystems #tarpon100 #womenwhoexplore #thenomadstories #herwanderfullife #wandernorthga #discovering_captures #optoutsidegeorgia #optoutside #getoutsidegeorgia #getoutside #southernroamer |
May 3 |
Social |
Instagram |
It's Coming! Mark Your Calendars now! This is one of the largest Paddlesports Demo Days and conveniently located in FarmVille, Virginia.#paddleva #kayakfishing #kayakbassfishing #wildernesssystems #hobiefishing #jacksonkayak #nativewatercraft |
May 3 |
Social |
Instagram |
Don't you wish you could drop in at the #base of the #hooverdam #kayaking #blazinpaddlestour #blazinpaddles #kayaktours #kayaking #arizona #coloradoriver #nevada #lasvegas #offthestrip #willowbeach #emeraldcave #aquabound #wildernesssystems #gopro #iphone |
May 3 |
Forums |
NorCal Kayak Anglers |
Re: Introducing the Wilderness Systems Radar 115 & 135 *see PDF files at bottom |
May 3 |
Social |
Instagram |
Nice little bass I caught on some skinny water yesterday! ------------------------------------ DM me or #kayakcatches for a feature! #kayak #kayakfishing #kayakcatches #kayaking #yakattack #yakaddicts #jacksonkayak #wildernesssystems #fishing #bassfishing #outdoors #largemouthbass #LMB #creekfishing #creeklife #riverfishing #riverlife #freshwaterfishing #saltwaterfishing #savetheskinnywater #follow #like |
May 3 |
Social |
Instagram |
#kayaking #kayakfishing #kayakadventure #selfie #yorktown #seaford #ocean #saltwater #saltlife #saltwaterfishing #wildernesssystems #onshore #shorething #beachlife |
May 3 |
Social |
Instagram |
Lateral line sex appeal #wildernesssystems #wernerpaddles #shimanoreels #dobynsrods |
May 3 |
Social |
Wilderness Systems Kayaks FB |
Go where most boats can't go! #WildernessSystemsKayaks |
May 3 |
Social |
Wilderness Systems Fishing Kayaks FB |
Stable, comfortable and durable - Wilderness Systems Kayaks! #Wildyfishing |
May 3 |
Social |
Instagram |
Nice bass I caught off the Coosa HD the other day! ----------------------------------------- DM me or #explorekayakfishing for a feature! #kayak #kayakfishing #kayaking #yakattack #yakaddicts #jacksonkayak #wildernesssystems #fishing #bassfishing #outdoors #largemouthbass #LMB #creekfishing #creeklife #riverfishing #riverlife #freshwaterfishing #saltwaterfishing #savetheskinnywater #follow #like |
May 2 |
Social |
Instagram |
One of our customers took his new @wildernesssystems Radar 135 with Pedal Drive out for his first spin last weekend in Florida. Thanks for sharing Nic! This thing is a beauty. #kayakfishing #wernerpaddles #ctug #wildernesssystems #radar135 #helixpd #yakattack #floridafishing #destinfishing #humminbird #fishing #redfish #quiversports #quiver_sports |
May 2 |
Social |
Instagram |
Breakfast with a view. I love my kayak. #Kayakfishing #kayaking #greatoutdoors #jetboil #wildernesssystems #frontierx #cameracase #hardcase |
May 2 |
Social |
Instagram |
Bridge over the river Mon near Greensboro, PA. #monongahelariver #kayaking #wildernesssystems |
May 2 |
Social |
Wilderness Systems Kayaks FB |
Who else loves to start their day like this? #WildernessSystemsKayaks |
May 2 |
Social |
Instagram |
Weekends are for paddling lakes and exploring islands °°♀️°°°° #LakeLanier #LakeLanierIslands #PitbullsofInstagram #WildernessSystems #Kayaking |
May 2 |
Social |
Instagram |
Monday Funday. Had the whole millpond to ourselves yesterday - #nc #kayaking #ncstateparks #paddling #kayak #optoutside #nc100miles #outdoors #merchantsmillpond #draintheswamp #nature #water #cypressswamp #cypresstrees #wildernesssystems #tarpon120 #yaklife |
May 2 |
Videos |
Youtube |
Tarpon On A Tarpon (Wilderness Systems Tarpon 140) |
May 2 |
Videos |
Youtube |
Derwent Water Kayak Tour |
May 1 |
Forums |
NorCal Kayak Anglers |
Re: Ff battery pack |
May 1 |
Social |
Instagram |
#camecuaro #michoacan #camecuaroenkayak #kayakmaniafishing #kayaks #kayakfishing #wildernesssystems #kayakanglers #yakfishing #kayaking #kayakadventures |
May 1 |
Social |
Instagram |
#kayaking #Teifi #Teifigorge #Tarpon #wildernesssystems #tarpon140 #tarpon120 #westwales #wales |
May 1 |
Forums |
/r/Kayaking |
Advice on kayak model |
May 1 |
Social |
Wilderness Systems Fishing Kayaks FB |
That moment $30,000 is on the line and you put a big one in the net. #wildyfishing #KBF #NationalChampionship Craig Dye Photo: Mike Ernst |
May 1 |
Social |
Wilderness Systems Kayaks FB |
You know what people love about Wilderness Systems Kayaks? They love how comfortable they are! |
Apr 30 |
Social |
Instagram |
I wanted to upgrade my old jet ski trailer to a kayak trailer for years. The old wooden bunks worked, but I'm very happy with the Malone Crossbar Kit. I had to get a little creative and swap out a pair of u-bolts, but it was an easy conversion. #kayak #trailer #malone #crossbars #fishing #kayaking #wildernesssystems #wildyfishing #ack |
Apr 30 |
Social |
Instagram |
Today we are putting the sport in #sportwagon! Enjoying #spring #kayaking on the #toccoariver - - - - - #unitedoutside #optoutside #vwlife #vwlove #vwfamily #4motion #mk7 #wagon #vw #6speedmanual #kayak #tarpon120 #paddling #georgiaoutdoors #wandergeorgia #outsideisfree #adventure #peacefulfloat #wildernesssystems #perfectweather #justgoshoot #samsunggalaxys7 |
Apr 30 |
Social |
Wilderness Systems Fishing Kayaks FB |
Tag your friend who would tell you he caught a lunker! :) |
Apr 30 |
Social |
Instagram |
13km recreational #kayak trip New Kahovka(Dnipro river) / Ukraine #kayakingkherson #vplavni #Dagger #alchemy #wildernesssystems #zehyr #wernerpaddles |
Apr 29 |
Social |
Instagram |
So relaxing!!! °#kayaking #lake #adventure #relaxing #beautifulday #hot #sunny #wildernesssystems #husband #love #fun #instagram #jrphotoobsession #fishing |
Apr 29 |
Social |
Instagram |
Kayaking adventure this Friday afternoon. #kayaking #adventure #lake #fishing #outdoors #wildernesssystems #nature #fun #beautifulday #hot #goproquik #love #instagram #jrphotoobsession |
Apr 29 |
Social |
Standup Journal FB |
Demo day alert! Check out the annual Kayak and SUP Demo. Reps on hand from Native, Hurricane, Wilderness Systems, Hobie, BIC SUP, Exocet and Progressive Boards. Reps and staff on hand to assist with demo and answer questions: http://standupjournal.com/paddleboard-events/sandy-point-progressive-sports-kayak-sup-demo/ |
Apr 29 |
Social |
Instagram |
@pherro @gill_far #iphone #perceptionkayaks #wildernesssystems #wernerpaddles #kayaking #yaklife #paddle #spring #nature #getoutstayout #bluesky #outsideisfree #wander |
Apr 29 |
Social |
Instagram |
#kayaking #WildernessSystems #Fishing |
Apr 29 |
Social |
Instagram |
Big #sale today down at #westerncanoekayak come down and see what all the hype is about. And maybe bring home a #wildernesssystems #kayak #clippercanoe #jacksonkayak #hobiekayak or a #starboard #paddleboard |
Apr 29 |
Social |
Instagram |
2 hogs from today. Other bass@have been caught but these are the best so far. The day is not over!#fishing #bassfishing #largemouth #largemouthbass #largemouthbassfishing #lifestyle #myaddiction #lakelife #lake #catchoftheday #catchandrelease #cantstopwontstop #nature #picoftheday #pictureoftheday #thetugisthedrug #thegreatoutdoors #kayakangler #kayakfishing #kayaking #wildernesssystems #rippinlips #bassmaster #senco #chatterbait #selfie |
Apr 29 |
Social |
Instagram |
Derelict railroad bridge over the Mon. #kayaking #monongahelariver #wildwonderful #wildernesssystems #prickettsfort |
Apr 29 |
Social |
Wilderness Systems Kayaks FB |
Good thing they were Wilderness Systems Kayaks! The toughest most durable kayaks. #WildernessSystemsKayaks |
Apr 29 |
Social |
Wilderness Systems Fishing Kayaks FB |
Go where other boats can't go this weekend! #Wildyfishing |
Apr 29 |
Social |
Instagram |
We have a beautiful weekend before us ... What's your plan of #ATAK?? GetPaddling! Resource Page at link in profile. PC: @otislinkous #gopcstaff #weekendready #gopcgreensboro #gso #greensboro #traid #nc #northcarolina #kayak #kayaking #kayakfishing #kayakfishingnc #wildernesssystems #onthewater #getpaddling #weekendgoals #lifeoutside |
Apr 29 |
Social |
Instagram |
A cloudy sunset. #kayak #kayaking #kayaklife #explore #explorenb #newbrunswick #canada #wildernesssystems #paddle |
Apr 29 |
Social |
Instagram |
Kayak selfie. With bonus dog. #kayaking #paddling #boating #rhodeisland #perception #wildernesssystems #perceptionkayaks #wildernessystemskayaks #dogsofinstgram #puppiesofinstagram #dog #puppy #rescuedog #adoptdontshop #dachshund #jackrussell #beagle |
Apr 29 |
Social |
Instagram |
'Open your door and go explore.' - Aimless Adventures #ExploreMore #AdventureOn #kayaking #outdoorlife #wanderlust #dontfencemein mein #wildernesssystems #tarpon120 #livelifeoutloud #getoutthere #getoutdoors #outdooradventures #riverlife #saltlife #wildernesssystemskayaks #wildernesskayaks #yakattack #kayakcamping |
Apr 29 |
Social |
Instagram |
Ahhhh....#relaxing #kayak #kayaking #kayakingadventures #kayaktrip #tampa #tampabay #wildernesssystems #wildernesssystemskayaks #tarpon160 #canoecountry @canoecountryfl |
Apr 28 |
Social |
Instagram |
Newest addition to the Angry Anvil Plastic Fleet. Been wanting one of these since they came out. My Wilderness Systems ATAK 140 loaded up and ready to go. big thanks to my buddy @saltyhamm for selling it to me. With a good stop at @paddleva in Hampton for some extra gear to get me going. Thanks for the help, always great to go there. #kayakfishing #kayakbassfishing #kayak #watersports #itswhatido #lovetheoutdoors #outdoors #water #kayaking |
Apr 28 |
Social |
Instagram |
The #hooverdam was releasing #water today . Made for an #easy and #beautiful #paddle down the #river for #blazinpaddles #fulldaytour #beautifulweather #aquabound #gopro #iphone #offthestrip #wildernesssystems #kayaking #kayaktours #kayak #hotsprings #arizonahotspring #goldstrikecanyon #arizona #lakemeadnationalrecreationarea #lakemead #willowbeach #emeraldcave #exhausted |
Apr 28 |
Social |
Instagram |
!!!!!!!LINK IS IN BIO!!!!!Hey guys I just uploaded the full video on YouTube. Go check it out and let me know what you think!!!!! . . . . . . . . #alwaysactive #bowhunting #fishing #kayaking #carp #redneck #swamp #conoe #active #wildernesssystems #pacifcnorthwest #kayaking #fish #hunting #survival #tactical #bushcraft #pacifcnorthwest #pnw #washington #outdoors #upperleftcorner #usa #murica #boats |
Apr 28 |
Social |
Instagram |
Couple bass caught but here's my best of the night. #bass #bassfishing #lmb #largemouth #largemouthbass #largemouthbassfishing #bucketmouth #catchandrelease #catchoftheday #picoftheday #pictureoftheday #kayakangler #kayakfishing #kayaking #spring #nature #thetugisthedrug #thegreatoutdoors #fish #lifestyle #myaddiction #bassmaster #wildernesssystems #rippinlips #bentrods #fishon |
Apr 28 |
Social |
Instagram |
It's a wrap!! Rincón, Golfo Dulce, Osa Península, Costa Rica #junglekayaking #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing |
Apr 28 |
Social |
Instagram |
Dam! This place was nice ° Dan did not enjoy himself one bit. #kayaking #kayak #yak #perception #wildernesssystems #newhampshire #paddling #water #dam #nature #funcouplestuff #kayaklife #kayakadventures |
Apr 28 |
Social |
Instagram |
Spontaneous afternoon kayak trip. #kayak #kayaking #yak #perception #wildernesssystems #paddle #water #kayaklife #kayakadventures #forced #dilf #funcouplestuff |
Apr 28 |
Social |
Instagram |
Beast! #beast#pike #pikefishing #bass #bassfishing #beastmode #rippinlips #bentrods #fishing #fish #wildernesssystems #nature #spring #catchoftheday #catchandrelease #picoftheday #pictureoftheday #freshwater #freshwaterfishing #thetugisthedrug #thegreatoutdoors #kayakangler #kayakfishing #kayaking #kayak#lake #lakelife #lifestyle #myaddiction |
Apr 28 |
Social |
Instagram |
Feels like summertime, and the livin' is easy // 4.28.17 #florida #naturecoast #kayaking #gulfcoast #wildernesssystems #cleanwater #river |
Apr 28 |
Social |
Instagram |
Flashback to Folly #follybeach #kayaking #kayak #wildernesssystems #ocean #beach #boat #boats #birdsofinstagram #birds #seagull #southcarolina #adventure #wanderlust #photographer #photography #vscocam #vsco #instagood |
Apr 28 |
Social |
Wilderness Systems Fishing Kayaks FB |
'I don't think it's love..it's an addiction' #atpaddles #wildyfishing |
Apr 28 |
Social |
Wilderness Systems Kayaks FB |
The kayak fishing addiction. What you paddle makes all the difference. |
Apr 28 |
Social |
Instagram |
Friday's Finds are Back! 1) Wilderness Systems ATAK 120 rudder install w/ Chase Tanner 2) Free Fall Visuals in the Sierras. 3) Josh Dolin, of Jackson Kayak, and Grant Alvis, of Hobie Fishing, chasing big blues in RVA. 4) Bobby Rae Allen and Big Briery Creek Lake bass. 5) The Free Fall Visuals crew puts together an excellent short on Patagonia. 6) And Rob Choi brings the Ruckus! Click the link in our profile for the goods! #paddleva #kayakfishing #RVA #whitewaterkayaking #wildyfishing #lynchburgva #richmond |
Apr 28 |
Social |
Instagram |
She cleaned up good but found a passenger that didn't make it. Rain got it last night. Poor little lizard. #kayakfishing #kayakbassfishing #kayak #watersports #itswhatido #lovetheoutdoors #outdoors #water #kayaking #wildyfishing #wildernesssystems |
Apr 27 |
Social |
Instagram |
When was the last time you did something for the first time? Yesterday I tried bow fishing,and I think I'm hooked. . . . . . . . . . #alwaysactive #fishing #bowfishing #hunting #archery #kayaking #swamp #hunt #wildernesssystems #trophy126 #washington #pnw #pacifcnorthwest #relax #active #outdoors #survive #redneck #bushcraft #bowhunting |
Apr 27 |
Social |
Instagram |
Ontario Mill Pond on the Pigeon River in Howe, IN. #iphonephotography #kayaking #wildernesssystems #water #outdoors #dam #kayak |
Apr 27 |
Social |
Wilderness Systems Fishing Kayaks FB |
Can your kayak do that? Wilderness Systems Kayaks, the most STABLE AND COMFORTABLE kayaks you can buy! #WildyFishing #ATAK |
Apr 27 |
Social |
Wilderness Systems Kayaks FB |
'One way to get the most out of life is to look upon it as an adventure.' #WildernessSystemsKayaks |
Apr 27 |
Social |
Instagram |
Lake Keowee in South Carolina. The upcountry in South Carolina has some beautiful mountain lakes. The best views are from a kayak in the middle of the water ° #lakekeowee #keoweetoxawaystatepark #southcarolina #kayaking #paddling #lake #mountainlake #mountains #appalachianmountains #outside #getoutside #outdoors #thegreatoutdoors #travel #wander #traveler #wanderer #travels #trip #traveling #travelgram #wanderlust #gopro @wildernesssystems |
Apr 27 |
Social |
Instagram |
Here's a favorite from when #TheLodge guys took a long weekend in the St. Regis Canoe area. Stay tuned for some shots from our next trip in June. #throwback #tbt #ADK #kayaking #wildernesssystems #pungo120 |
Apr 27 |
Social |
Instagram |
Got a couple lunkers this afternoon #fishing #fisheveryday #kayaking #kayak #kayakfishing #puremichigan #lunker #lunkers #lunkerchasers #lmb #largemouthbass #largemouth #bass #bassfishing #bassproshop #wildernesssystems |
Apr 27 |
Social |
Instagram |
Dog approved! Day off, beautiful sun came out in the afternoon so we hit the water! #liveyourlife #lifeisgood #lovelife #selfcare #adventuredog #adventureawaits #alifeoutdoorsisalifewelllived #authentic #dogapproved #dogofinstagram #dog #kayak #kayaking #kayakingdog #puremichigan #kayakingwithdogs #wildernesssystems #beautifulday #sunnyday #suncameout #happydog #happylife #happyclouds |
Apr 26 |
Social |
Instagram |
Beautiful #alabamasunsets #kayaking #kayakfishing #bassfishing #itsinmynature #wildernesssystems #perceptionkayaks #wherethemountainsmeetthelake |
Apr 26 |
Social |
Instagram |
Medina lake w/ @vertical7crawlers #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy |
Apr 26 |
Social |
Instagram |
Mogos, Golfo Dulce, Osa Península, Costa Rica #junglekayaking #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing |
Apr 26 |
Social |
Instagram |
Last night we prepped for today's #waterwednesday Brandon had to float his new boat while little K practiced her paddling. What better way to spend some good Daddy daughter time. #kayaking #kayaks #wildernesssystems #daggerkayaks #familytime #outdoorfamily #optoutdoors #optoutside #beoutside |
Apr 26 |
Social |
Instagram |
My new kayak Atak 140...this bad boy is really gonna get me on some fish quick. #kayaking #kayak #atak #wildernesssystems #fishing° #bassfishing #tightlines #kayakbassfishing |
Apr 26 |
Social |
Instagram |
Being a Christian makes me a better adventurer.I know that many people think that once you gave your life to Jesus you become boring and don't do anything fun.Honestly I question those peoples faith but that's a different topic....every bible character in the Bible that committed their life to Jesus lived an epic life. Pual?man that dude was gnarly.He was a crazy backpacker that would hike across desserts to preach,Moses,crazy dude right there...first off, at age 120 he was strong as a young man,also he would go to the mountains for months to find the connection with God. King David?Uhm HELLO!!!!My hero right there. Don't even have to explain how he was a crazy mofo!!!! Say ya life of a Christian should be an epic adventure.Of course everything has to have a balance,there's time to go to church and adventure shouldn't interfere with that.Theres time for work/school/family,all that has a place but sitting around doing nothing, ya Christians shouldn't have time for that. °✍️°✍️°✍️°✍️°✍️° Seriously comment below any bible character that committed his life to Jesus and didn't have an epic life... I can't think of a single person so if you can ,let me know down below cuz I'm curios. Monday,Tuesday,Wednesday,Thursday,Friday,saterday,Sunday What do you know?we don't have 'someday'so if u wanna do great things,do it TODAY because someday will never come . . . . . . . . . #alwaysactive #outdoors #cali #roadtrip #surfing #kayaking #oceankayaking #pictureoftheday #pacificnorthwest #picoftheday #gopro #extreme #sandiago #califor nia #westcoast #adventure #active #relax #fishing #conoe #wildernesssystems |
Apr 26 |
Social |
Wilderness Systems Kayaks FB |
You know why so many people tell us they LOVE Wilderness Systems Kayaks? They are the most maneuverable kayak they have ever owned! #WildernessSystemsKayaks 📷: @padleketil |
Apr 26 |
Social |
Instagram |
The rains are here, and we all know that that means... IT'S PADDLING SEASON!! • Drop by @packratoc today and get outfitted for your next float. • #paddling #floating #kayaking #canoeing #river #creek #whitewater #waterfall #buffaloriver #mulberryriver #richlandcreek #kingsriver #packratoc #fayetteville #arkansas #nrs #astral #liquidlogic #perception #wenonah #madriver #wildernesssystems #dagger |
Apr 26 |
Social |
Wilderness Systems Fishing Kayaks FB |
Want to catch more fish? Go where boats can't go! Get the safest and most comfortable kayak on the market - Wilderness Systems Kayaks. #Wildyfishing 📷: Pro Staffer Matt Eikenberg |
Apr 26 |
Social |
Wilderness Systems Fishing Kayaks FB |
Wilderness Systems pro staffer Kris Cortez on spearfishing from a kayak! http://www.wildernesssystems.com/us/experience/team-blog/297/post/spearfishing-kayak |
Apr 26 |
Videos |
Youtube |
[Best Seller] Wilderness Systems Aspire 105 Kayak Sonar One Size |
Apr 25 |
Social |
Instagram |
In rush to escape. Few minutes later 20m/s wind gusts covered the area. #wildernesssystems #wernerpaddles #kayakingkherson #kayak #vplavni |
Apr 25 |
Social |
Instagram |
Short stop prior to paddling in heavy winds. Chaika river Kherson region / Ukraine #wildernesssystems #kayak #vplavni #wernerpaddles #kayakingkherson #gopro |
Apr 25 |
Social |
Instagram |
We were featured in a local thingy, what a good picture of us! @tiffanythib #vermilionriver #reptheriver #louisiana #kayaking #wildernesssystems #nativewatercraft #paddle #river #kayak #goodtimes #boatparade #bayouvermilion #bvdboatparade #thethib #bendingbranches #yaklife |
Apr 25 |
Social |
Instagram |
#ExploreMore #kayaking #liveyouradventure #GetOutThere #AdventureOn #exploreyourworld #liveyouradventure #adventureisoutthere #kayaklife #riverlife #saltlife #yaklife #tarpon120 #WildernessSystems |
Apr 25 |
Social |
Instagram |
Near Rincon River, Golfo Dulce, Osa Península, Costa Rica #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing |
Apr 25 |
Social |
Instagram |
Dnipro river crossing in heavy winds. #kayakingkherson #vplavni #wernerpaddles #wildernesssystems #kayak |
Apr 24 |
Social |
Instagram |
04-23-17: Paddling Lake Moultrie's Santee Canal in Berkeley County SC. This paddle had a variety of ecosystems, beautiful scenery, calm, quiet paddle and wildlife that included alligators, herons and eagles #blazethattrail #paddling #paddle #kayak #kayaking #paddletrail #blueway #watertrail #water #lake #lakemoultrie #wildernesssystems #photography #wildlife #berkeley #berkeleycounty #canoe #canoeing #onlyinsouthcarolina #wanderlust #southcarolina #lowcountry #tourism #nikon |
Apr 24 |
Social |
Wilderness Systems Kayaks FB |
So so not ready for Monday! #WildernessSystemsKayaks |
Apr 24 |
Social |
Instagram |
Nothing super special today, however, I've now been on the water more times than I've been in the last two years combined. It's only April! Also, I love when the trees are budding. That bright green haze over the skeleton of the tree. Love spring! . . . . . . . #explore #explorewisconsin #TravelWI #chainolakes #lifeisgood #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #liveauthentic #livesimply #kayak #kayaking #kayaklife #kayakgram_feature #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene #beautifuldestinations #kayaklyfe #paddlingmixtape #lifehappensoutdoors #nomadkayaking #campistco #thediscoverer |
Apr 24 |
Social |
Wilderness Systems Kayaks FB |
Nothing better than padding into the sunset! #WildernessSystemsKayaks |
Apr 24 |
Social |
Wilderness Systems Fishing Kayaks FB |
Is your kayak this stable? #WildernessSystemsKayaks Wilderness Systems Pro Staff Eugene Mora shows off just how stable the ATAK can be. |
Apr 24 |
Videos |
Youtube |
[Best Seller] Wilderness Systems Ride 135 Kayak - Low Outfitting Mango (Orange/Yellow Blend) |
Apr 23 |
Social |
Instagram |
Ready for some paddling #kayaking #edmontonwhitewaterpaddlers #wildernesssystems #tempist |
Apr 23 |
Social |
Instagram |
Just another day in paradise, Golfo Dulce, Osa Península, Costa Rica #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing #stonemountainoutdoors |
Apr 23 |
Social |
Instagram |
Paddling happiness via @barrywalstead Taken from the #amazing @wildernesssystems #radar135 with the new #helixpd #pedaldrive |
Apr 23 |
Social |
Instagram |
Calm waters and a blanket of snow. #kayak #kayaking #kayaklife #yaklife #wildernesssystems #paddle #spring #adventure #explore #explorenb #newbrunswick #canada #saintjohnriver #sunday #sundayfunday #followme #travel #instagood #picoftheday #peaceful |
Apr 23 |
Videos |
Youtube |
[Best Seller] Wilderness Systems Tarpon 100 Kayak, Factory Seconda� Red One Size |
Apr 23 |
Social |
Wilderness Systems Fishing Kayaks FB |
Who else isn't ready for Monday? #WIldyFishing 📷: Cory Dreyer |
Apr 23 |
Social |
Instagram |
It was nice at first but got rough fast.. nothin but Spanish Mackerel.. @peachestlh #kayaking #kayakfishing #wildernesssystems #pelagic #offshore #perdidokey #pensacola |
Apr 23 |
Social |
Instagram |
Just another day in paradise, Golfo Dulce, Osa Península, Costa Rica #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing |
Apr 23 |
Social |
Instagram |
#litchfieldpark #kayaking #pungo120 #wildernesssystems #nobarkingdogshere |
Apr 23 |
Social |
Instagram |
We see some cool boats come through our repair center at the shop. This one came in for a bit of touch up. We discovered it was a custom build by Wilderness Systems from the 90s, all Kevlar. . . . . . . . . . #canoecountryfl #ccofl #custom #kevlar #seakayak #wildernesssystems #kayaking #paddling #stpete #florida #tampabay |
Apr 23 |
Social |
Instagram |
Our Annual Kayak/SUP Demo is next weekend! Saturday April 29th, from 8am-1pm. Our event will be held at the Port Orange Causeway by the North-West dock. There will be a very large selection of kayaks and paddle boards to try out. Let us help find the right kayak or board for you. Go check out our Facebook event and set the date! ➡️➡️https://www.facebook.com/events/145989779256619/?ti=icl⬅️⬅️ #kayaking #sup #demo #outdoors #water #Florida #hobie #wildernesssystems #jacksonkayak #surftech #exocet #progressive #bicsup |
Apr 22 |
Social |
Instagram |
Her first adventure with me will be tomorrow . Let's hope she treats me like the as well as my Cuda14 #kayakfishing #kayaking #wildernesssystems#tarpon140 #saltwaterfishing #wernerpaddles |
Apr 22 |
Videos |
Youtube |
WILDERNESS SYSTEMS Tarpon 100 Kayak, Factory SecondA� Red One Size |
Apr 22 |
Social |
Instagram |
Heading out in the morning with the whole family for our first paddle all together. #kayaking #kayak #kayakgram #family #perceptionkayaks #oldtownkayak #wildernesssystems #hondaridgeline #southernliving #southerncharm #paddlefaster #getoutside |
Apr 22 |
Forums |
/r/kayakfishing |
Kayak crate solutions |
Apr 22 |
Videos |
Youtube |
Wilderness Systems Thresher 140 Kayak With Rudder Mango Orange One Size |
Apr 22 |
Social |
Instagram |
Paddling happiness! Taken from the #amazing @wildernesssystems #radar135 with the new #helixpd #pedaldrive #paddlingmixtape #kayak #kayaking #seakayak #paddling #pugetsound #theafoss #sunshine @eddylinekayaks @sealsskirts @shiptoshoremarine @wildyfishing |
Apr 22 |
Social |
Instagram |
Summer is coming!! . . . . . #vashonvintagebeachhouse #cabinlife #cabin #beach #beachhouse #pugetsound #mtrainier #airbnb #vrbo #tripadvisor #beachhousedecor #mycovetedhome #weekendgetaway #vashonisland #vashon #pnw #pacificnorthwest #pnwexplorations #pnwlife #pnwonderland #upperleftusa #island #coastalliving #cabinporn #kayaking #vashonlife #paddle #wildernesssystems |
Apr 22 |
Social |
Instagram |
Kayaking in 50 degree rain, earned us some warm up time by the fire. #vapingsavedmylife #wildernessmen #wildernessculture #kayaking #kayakcamping #weekend #weekendvibes #wildernesssystems #family #fire #fireplace |
Apr 22 |
Social |
Instagram |
YouTube review for the Helix PD in the works. Subscribe to my channel, link in bio. °° #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy #helixpedaldrive #radar #radar135 #yaklyfe |
Apr 22 |
Social |
Instagram |
Radar 135 w/ Ram Tubes #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy #rammounts |
Apr 22 |
Social |
Instagram |
Good day of fishing today. 9 bass total #fishing #bassfishing #largemouth #largemouthbass #largemouthbassfishing #catchoftheday #catchandrelease #cantstopwontstop #lifestyle #nature #thetugisthedrug #thegreatoutdoors #selfie #fish #freshwater #freshwaterfishing #rippinlips #bentrods #myaddiction #picoftheday #pictureoftheday #spring #springfishing #kayakfishing #kayakangler #kayaking #kayak #wildernesssystems #ilovefishing |
Apr 22 |
Social |
Instagram |
Hooked up #kayaking #tarpon140 #wildernesssystems #redfish |
Apr 22 |
Social |
Instagram |
I think our first date went well °#tarpon140 #wildernesssystems #limit #kayakfishing #shimano #pfg #chickenboylures #kayaking #texascoast #marsh |
Apr 22 |
Social |
Instagram |
#virginiabeach #dobynsrods #wildernesssystems #wernerpaddles |
Apr 22 |
Social |
Instagram |
Jake caught an award winning pickerel. #fishing #kayaking #wilderness #wildernesssystems #lake #freshwater #catchandrelease #pickerel #nature #outdoors #happyearthday #earthday2017 #instagram #jrphotoobsession |
Apr 22 |
Social |
Instagram |
Our flag sticking out of the water. #kayak #kayaking #kayaklife #yaklife #wildernesssystems #explore #explorenb #adventure #gooutside #paddle #canada150 #activeon |
Apr 22 |
Social |
Instagram |
Radar 135 with the Helix PD. Sexy... #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildernesssystems #wildy #starwars #r2d2 |
Apr 22 |
Videos |
Youtube |
[Best Seller] Wilderness Systems Aspire 105 Kayak Mango Orange One Size |
Apr 22 |
Social |
Instagram |
Just breaking her in !! #tarpon140 #wildernesssystems #kayaking #saltwaterfishing #wernerpaddles #columbia #redfish #shimano |
Apr 22 |
Social |
Instagram |
Early rise on Lake Carroll ° #carrollton #georgia #saturday #morning #sunrise #kayak #kayaking #paddling #lake #getoutside #outdoors #optoutside #active #recovery #lifestyle #wildernesssystems #gopro |
Apr 22 |
Social |
Wilderness Systems Fishing Kayaks FB |
Can your kayak do that? #WidernessSystemsKayaks the most STABLE kayaks available! #Wildyfishing |
Apr 22 |
Social |
Instagram |
04-22-17: Loaded up and ready for tomorrow's mystery adventure and photo shoot. It's officially for work (wink) ...more information and awesome pics coming soon ° #blazethattrail #coolestcompanies #paddling #paddle #paddletrail #kayak #kayaking #blueway #watertrail #water #oceankayak #lowcountry #wildernesssystems #adventure #wanderlust #yakimaracks |
Apr 22 |
Social |
Instagram |
Happy Earthday! Great day to be outside...#enoughpollenalready . . #adventure #adventuretramps #shootthehooch #kayaking #happyearthday #wildernesssystems #tarpon120 #sunburn #advlife #getoutstayout #carlislepaddles |
Apr 21 |
Social |
Wilderness Systems Kayaks FB |
When purchasing a kayak, everyone has different things that are important to them. What is most important to you when buying a kayak? #WildernessSystemsKayaks |
Apr 21 |
Social |
Instagram |
No pushing and shoving for campsites out here. You got the whole #island to yourself! #beachcamping #kayaking #wildernesssystems #noreservations #exuma #explorethebahamas #kayakgram credit: Diane C. |
Apr 21 |
Social |
Instagram |
Doing a review on the Helix PD. #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #bassfishing #bass #reds #redfish #basspro #water #fish #texas #wildy #wildernesssystems |
Apr 21 |
Social |
Instagram |
Off to the races. #kayaking #wildernesssystems #tarpon #paddlefaster #beavercreek #lakewateree #bassethound #prettyboy that's the dog's name. |
Apr 20 |
Social |
Instagram |
Took my new #perception Kayak for a test run last night and so far I'm very happy with my purchase. It is stable, tracks well and has a very comfortable seat. After using my Wilderness Systems Pungo for 15 years I decided it was time to upgrade. I again went with another trusted brand which is manufactured by the same company as my first. I expect many years of use with this one as well. The ladyfish bite was great last night and also had a young curios Manatee hang out with me for a bit. #kayak #kayaking #kayakfishing #perceptionkayaks #sunset #florida #floridagulfcoast #hernandobeach #thisishernando #fladventurecoast #confluenceoutdoors |
Apr 20 |
Social |
Wilderness Systems Kayaks FB |
Who's ready for the weekend? Whatever you have planned, we hope it includes some time spent in your Wilderness Fishing Kayaks!! |
Apr 20 |
Social |
Instagram |
Relaxing my brain ° #seakayaking #seakayak #kayaking #kajak #kayak #capetownmag #lovecapetown #capetown @sawyeroars #kayakingislove @wildernesssystems @pelicanprofessional @lovecapetown @capetownlately @capetownmag |
Apr 20 |
Social |
Instagram |
We paddled 2.6 miles through small craft warnings to get to Bear Island...and the same back. Who needs a gym? #wildernesssystems #kayaking |
Apr 20 |
Social |
Instagram |
A video just for @porschlund . And I now realise your surname is NOT what I said. Apologies. The handle confused me and I had a terrible day so my brain was fried and I need this paddle. With some red wine and a pasta dish I have almost completed combined with the paddle life is good again. I also jinxed myself and within minutes a small wind picked up, shortly thereafter to maybe 15 knots and then dropped to maybe 5 on the way home. Great evening °✌ #seakayaking #seakayak #kayaking #kajak #kayak #capetownmag #lovecapetown #capetown @sawyeroars #kayakingislove @wildernesssystems |
Apr 20 |
Social |
Wilderness Systems Fishing Kayaks FB |
Is there any better feeling than a sunrise on the water? #WildyFishing |
Apr 20 |
Social |
Wilderness Systems Fishing Kayaks FB |
Good day for the Wildy fishing pro staff at the YakAddicts Three Rivers Throwdown tourney in GA last weekend. Shane Williams won Big Bass with a monster shoal bass, Reggie Diaz caught his personal best large mouth, and Brad Case took home first place. Congrats boys! #wildyfishing #yakaddicts |
Apr 20 |
Social |
Instagram |
When your trying to snap out of a snag and then all of a sudden the snag starts fighting back @wildernesssystems @wildyfishing #tarpon120 #wildernesssystems #kayak #kayak_fish #kayakangler #kayaking #kayakfishing #sea° #sea #seafish #seafishing #seafishinguk #fish° #fishing #fisherman #fish #angler |
Apr 20 |
Social |
Instagram |
Not the biggest but lovely coloured markings @wildernesssystems @wildyfishing @fredheath #sea #sea° #seafishing #seafishinguk #seafish #fishing #fish° #fisherman #flatfish #plaice #kayakfishing #kayaking #kayak #kayakangler #kayak_fish #kayak #wildernesssystems #tarpon120 |
Apr 19 |
Social |
Instagram |
Definitely not a big one but, First fish in the new yak! #bassfishing #largemouthbass #fishing #kayaking #kayakbassfishing #kayakfishing #wildernesssystems #ride135 #natescustombaits #ardentreels #rulethewater #teamardent #lakeforktrophylures |
Apr 19 |
Social |
Instagram |
Up Rio Tigre, Golfo Dulce, Osa Península, Costa Rica #kayakrental #rentals #selfguided #seakayaking #adventure #costarica #osapeninsula #golfodulce #golfito #puertojimenez #kayak #kajakk #kayaking #puravida #wildernesssystems #corcovadonationalpark #kayakfishing |
Apr 19 |
Social |
Instagram |
Boats, bros and beers! Feeling grateful for a glorious sunny kayak adventure today. Even more special when open water season is still 1 month+ away at home! #summeriscoming #kayaking #urbanpaddling #getoutside #wildernesssystems |
Apr 19 |
Social |
Instagram |
A full load down at the base of the #hooverdam . Can't get a better #viewpoint of that! #nevada #arizona #coloradoriver #kayaking #kayak #blazinpaddles #emeraldcave #willowbeach #wildernesssystems #offthestrip #lasvegas #mercedes #aquabound #gopro #iphone |
Apr 19 |
Social |
Instagram |
Morning fog. #kayak #kayaking #kayaklife #yaklife #wildernesssystems #fog #river #explorenb #explore #adventure #newbrunswick #gooutside #activeon |
Apr 19 |
Social |
Instagram |
Love those north woods sunsets! . . . . . . . #explore #explorewisconsin #TravelWI #pinelake #lifeisgood #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #liveauthentic #livesimply #kayak #kayaking #kayaklife #kayakgram_feature #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene #beautifuldestinations #kayaklyfe #paddlingmixtape #lifehappensoutdoors #nomadkayaking |
Apr 19 |
Social |
Instagram |
Love having the Fox River so close to home. Always a great paddle. . . . . . . #explore #explorewisconsin #TravelWI #foxriver #appletonWI #onegreatplace #lifeisgood #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #liveauthentic #livesimply #kayak #kayaking #kayaklife #kayakgram_feature #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene #beautifuldestinations #kayaklyfe #paddlingmixtape #lifehappensoutdoors #nomadkayaking #campistco |
Apr 19 |
Social |
Instagram |
#dobynsrods #wernerpaddles #shimano #wildernesssystems #astral |
Apr 19 |
Forums |
NorCal Kayak Anglers |
Re: GS11 Raffle!!! |
Apr 18 |
Forums |
NorCal Kayak Anglers |
Runaway kayak - looking for your comment |
Apr 18 |
Forums |
NorCal Kayak Anglers |
Re: Runaway kayak - looking for your comment |
Apr 18 |
Social |
Wilderness Systems Kayaks FB |
It's Monday! Who wishes they were here right now? Wilderness Systems Kayaks - Chasing Perfection |
Apr 18 |
Social |
Instagram |
Preferred morning coffee sipping spot. . . . . #explore #explorewisconsin #TravelWI #ilovekayaking #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #liveauthentic #livesimply #kayak #kayaking #kayaklife #kayakgram_feature #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene #beautifuldestinations #kayaklyfe #paddlingmixtape #lifehappensoutdoors #nomadkayaking #kayakcamping #camping |
Apr 18 |
Social |
Instagram |
Nothing beats the peace and perfection of paddling a still and crystal clear lake. . . . . . . #explore #explorewisconsin #TravelWI #ilovekayaking #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #liveauthentic #livesimply #kayak #kayaking #kayaklife #kayakgram_feature #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene #beautifuldestinations #kayaklyfe #paddlingmixtape #lifehappensoutdoors #nomadkayaking #kayakcamping #camping |
Apr 18 |
Social |
Instagram |
It was a #ladiesday #90yearsyoung!!!!! (Blue hat) #kayaking #mangroves #Kayakguidedtours #wildernesssystems #Matlacha |
Apr 17 |
Social |
Instagram |
#kayaking #kayak #explore #adventure #paddle #wildernesssystems #newbrunswick #gooutside |
Apr 17 |
Social |
Instagram |
#paddle #easter #kayak #perceptionkayaks #wildernesssystems #wernerpaddles #upacreek #explore #adventure #iphone #offtrail #dirtbags #nature #outsideisfree #spring #arch |
Apr 17 |
Social |
Instagram |
Angie #reflection #outdoorwomen #offtrail #womenwhoexplore #paddle #iphone #kayaking #yaklife #wildernesssystems #explore #creek #upacreek |
Apr 17 |
Social |
Instagram |
#easter #paddle #kayaking #yak #upacreek #wernerpaddles #wildernesssystems #perceptionkayaks #offtrail #adventure #dirtbags #iphone #nature @dannyeraydene @kevinmarbury |
Apr 17 |
Social |
Instagram |
Beautiful day with @fuzzymemory. #nofilter #nofilterneeded #nature #gonefishing #fishing #kayakfishing #kayaking #chesapeakebay #beach #virginia #coast #outdoors #adventure #atak #wildernesssystems #pennfishing |
Apr 17 |
Social |
Instagram |
It was a good birthday weekend. #kayak #subaruwrx #wildernesssystems #weekend #birthdayweekend #austin #atx #austintx #optoutside #outside #kayaking |
Apr 17 |
Social |
Instagram |
Hard not to be in love with this view. #britishcolumbia #bc #southerngulfislands #salishsea #gulfislands #penderisland #travel #travelphotography #landscape #landscapephotography #kayaking #paddling #photography #wildernesssystems @wildernesssystems (FYI kayak from @vporeddeer °°) |
Apr 17 |
Forums |
NorCal Kayak Anglers |
Re: Wilderness Systems Lithium Battery |
Apr 17 |
Social |
Instagram |
Sunset snook release, Everglades City, Florida. Go back and grow up. #snook #snookfishing #flyfishing #everglades #floridafishing #kayakfishing #kayaking #igersjax #wildernesssystems |
Apr 17 |
Social |
Instagram |
A paddle through the woods. #kayak #kayaking #explore #explorenb #adventure #gooutside #paddle #adventuretime #wildernesssystems #newbrunswick #peaceful |
Apr 17 |
Social |
Instagram |
Great day on the water. #kayaking #wildernesssystems #explorenb |
Apr 17 |
Social |
Instagram |
First kayaking trip of the year was a success. #kayaking #wildernesssystems #explorenb #getoutdoors |
Apr 17 |
Social |
Wilderness Systems Fishing Kayaks FB |
Look who's using Wilderness Systems Kayaks! |
Apr 17 |
Social |
Wilderness Systems Fishing Kayaks FB |
Is there any better feeling? It's that time of year! What are you fishing for this spring? #WildyFishing |
Apr 17 |
Social |
Instagram |
One pike tonight but getting to float around was more relaxing #fisheveryday #fishing #kayaking #kayakfishing #wildernesssystems #johnnymorris #bps #puremichigan |
Apr 17 |
Social |
Instagram |
04-16-17: Some of the aquatic plants on 'The Jungle' paddle at Lake Moultrie in Berkeley County SC. They will be in full bloom in a couple weeks. We're planning another trip back. Who wants to #blazethattrail with us? ° #paddling #kayaking #canoe #kayak #canoeing #watertrail #blueway #berkeleycountysc #onlyinsouthcarolina #monckscornersc #photography #discover_sc #discoversc #paddle #swamp #flowers #waterlily #lily #berkeley #berkeleycounty #tours #lake #nikon #water #paddletrail #paddle #wildernesssystems |
Apr 16 |
Social |
Wilderness Systems Fishing Kayaks FB |
Over $5000 raised for Heroes on the Water today at the Mission Bay Tournament in San Diego . |
Apr 16 |
Social |
Instagram |
Great Easter service then on the water enjoying #nature that the Lord has given ° #OptOutside #outdoors #solitude #kayaking #wolfriverconservacy #wildernesssystems #GoOutside #river #geekprocamera #Easter |
Apr 16 |
Social |
Instagram |
04-16-17: Another pic from today's paddle adventure at 'The Jungle' at Lake Moultrie. This research and photography is for a project for our partners at Berkeley County Economic Development. What a tough day 'at work' for our SC team ° #blazethattrail #coolestcompanies #berkeley #berkeleycountysc #lakemoultriesc #lakemoultrie #onlyinsouthcarolina #discover_sc #discoversc #paddling #kayaking #canoeing #paddletrail #blueway #tourism #lake #photography #nikon #paddle #swamp #cypress #alligator #wildernesssystems #water |
Apr 16 |
Social |
Instagram |
04-16-17: Team BLAZE exploring 'The Jungle' this morning at Lake Moultrie in Berkeley County SC. This will be part of our Berkeley County Guidebook. What an otherworldly place of beauty and adventure #blazethattrail #coolestcompanies #onlyinsouthcarolina #discover_sc #discoversc #berkeley #berkeleycountysc #monckscornersc #monckscorner #paddling #paddletrail #kayaking #canoeing #photography #watertrail #blueway #water #lakemoultrie #lakemoultriesc #moultrie #nikon #bendingbranches #wildernesssystems @bending_branches #tsunami #tsunami175 #tourism |
Apr 16 |
Social |
Instagram |
Happy Easter! Entering one of the many intriguing mangrove channels with some fellow paddlers making it out safely #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #miami #southflorida #biscaynebay #outdoors#wildernesssystems #gopro #zephyr160 #miamilife #kayakgram |
Apr 15 |
Social |
Instagram |
#wernerpaddles #wildernesssystems #yaklife #freshwater #adventuredog #waterdog #friday #skyporn #cloudlover #clouds #iphone #nature |
Apr 15 |
Social |
Instagram |
#paddle #kayak #wildernesssystems #adventure #yaklife #iphone #outdoors #freshwater #wernerpaddles #weekend #friday #outside #skyporn #clouds #cloudlover |
Apr 15 |
Social |
Instagram |
9 nautical mile paddle...Halfway point...still smiling... #livelovelaugh #funfunfun #kayaking #kayaklife #surfskate #justlife #beautifulwife #sober #sobriety #aa #na #narcoticsanonymous #alcoholicsanonymous #savannahgeorgia #savannahriver #tybeeisland #northislandsurfandkayak #thunderboltgeorgia #wildernesssystems #staystrong #waterman #waterwoman |
Apr 15 |
Social |
Instagram |
#readytogo прикол в том, что, когда я смотрю на эти лодки, мне хочется плыть на всех одновременно °°° Каждая модель рулится и ведёт себя совершенно по-раному, задавая свой ритм путешественнику. Совсем скоро мрачную серость бетонного фона сменит блеск прозрачной воды и витиеватый узор подмытых еловых корней. Угукание филина и раскатистый всплеск выпрыгивающей рыбы. #grayling #steelhead #salmon #buss #browntrout #trout #tarpon #salmon #shimano #wildernesssystems #nativekayaks #nativewatercraft #oceankayak #kayaking #kayaktours #flyfishing #fly #fishinginrussia #instafishing #instafish #семга #хариус #кумжа #форель #лосось #окунь #щука #русскийсевер #рыбалка #рыбалкавроссии |
Apr 15 |
Social |
Instagram |
Great day on the water #kayaking #wolfriverconservacy #wildernesssystems #GoOutside #nature #photography #serenity #fayettecounty #river #OptOutside # geekpro #wernerpaddles |
Apr 15 |
Social |
Instagram |
Tent. Hammock. Kayak. YETI full of quality food and beverages. My version of paradise. Went with the @bigagnes_ Big House 6 this weekend. Haven't used it in a few seasons and it's my go to car-camping tent. Didn't need the vestibule on for extra space since it's just me. #camping #getoutside #itsbetterinthewoods #dofunshit #bigagnes #wildernesssystems #kayaking #explore #virginia #yakimaracks #foxoutfitters #hammocktime |
Apr 15 |
Social |
Instagram |
Size doesn't matter right... ?? #smallmouth #kayaking #wildernesssystems thankful for spring °° |
Apr 15 |
Social |
Wilderness Systems Kayaks FB |
Survey time! Please take a few to help us design new best-in-class products for paddlers like you. After we receive the results, 1 lucky person will be drawn at random to win a $50 credit on Harmony Gear. Rules: Must be experienced with sit inside kayaks to take the survey and qualify for the prize. https://www.surveymonkey.com/r/X2WYN8P |
Apr 15 |
Social |
Instagram |
There's a lot worse ways to spend the weekend. #getoutside #camping #explore #virginia #yeticoolers #bigagnes #nemoequipment #wildernesssystems #kayaking #paddleva #arcteryx #deadbirdsociety |
Apr 15 |
Social |
Instagram |
#speing creek#esterobay #dogbeach#wildernesssystems #kayaking #kayakswfl #swfl #loverskey #florida#paddling #pictureesque #scenery |
Apr 15 |
Social |
Instagram |
Little rewards around every corner on these paddling days. Sorry to disturb this crane, but what a sight! Day #3 . . . . . . #explore #explorewisconsin #blackotterlake #lifeisgood #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #liveauthentic #livesimply #kayak #kayaking #kayaklife @wildernesssystems #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene #beautifuldestinations #kayaklyfe #paddlingmixtape #lifehappensoutdoors #nomadkayaking |
Apr 15 |
Social |
Instagram |
Kayak camping! Nice to get off the grid for a minute . @wildernesssystems @bigagnes_ #onnit #getonnit #cavemancoffeeco #cavemancoffee #albanyohd #killthequit #killcliff #kayaking #kayak #jordanlake #nc #nclakes #ryourogue #roguefitness #bigagnes #sunrise #camping #argylestyle #bigheadgym |
Apr 15 |
Social |
Instagram |
Went kayaking with Tim at Boggy Creek! #kayaking #fourcreeksstateforest #boggycreek #wildernesssystems #liquidlogic @critters.n.cars |
Apr 15 |
Social |
Instagram |
I was finally the one to catch the biggest fish lol. #wildernesssystems #kayakfishing #kayaking #wildflorida #bowfin @critters.n.cars |
Apr 15 |
Social |
Instagram |
Afternoon vibes. #easyday #getoutside #camping #kayaking #wildernesssystems #explore #virginia #arcteryx #paddleva |
Apr 14 |
Social |
Instagram |
These kids were pretty cool. #SCT #kayaking #traveloregon #thepeoplescoast #wildernesssystems #xcelwetsuits |
Apr 14 |
Social |
Instagram |
Late night therapy session #therapy #fishing #kayak #kayaking #BeaverLake #Rogers #rogersAR #RogersArkansas #Bentonville #BentonvilleAR #BentonvilleArkansas #NorthwestAR #northwestarkansas #paddlejunkies #perceptionkayaks #wildernesssystemskayaks #wildernesssystems #beautifulday |
Apr 14 |
Social |
Instagram |
If you #paddle and you live nearby you should come #paddling with me next week for #kayakskillsnight Every Thursday, 6pm to 7:30pm. Alternating between just paddling one week and skills the next. Gig Harbor Boat Launch. #paddlingmixtape #kayaking #seakayak #seakayaking #practice #practicemakesperfect #skills #gigharbor #radar135 #helixpd #wildernessystems @eddylinekayaks @stohlquistwaterware @wildernesssystems @wildyfishing @shiptoshoremarine |
Apr 14 |
Social |
Instagram |
Spring time in Kherson / Ukraine Gnilusha river 14.04.2017 #kayakingkherson #wernerpaddles #wildernesssystems #kayak |
Apr 14 |
Social |
Instagram |
Oleshki-Kherson trip. Approx 15km passed via Konka and Hnilusha rivers .Rainfall, calm, strong wind and blue sky later on met us today. #kayakingkherson #wildernesssystems #wernerpaddles #kayak |
Apr 14 |
Social |
Instagram |
WHAT!?! Impex Montauk $800 fiberglass sea kayak ° #WildernessSystems 14.5 ft Seacret $500 ° #perception kayaks Dancer $350 #goplayonthewater #kayaking #regear #kids4cleanwater |
Apr 14 |
Social |
Instagram |
#wildernesssystems #wernerpaddles #daiwa |
Apr 14 |
Social |
Instagram |
On the Cheat River above the confluence with the Monongahela River. #cheatriver #monongahelariver #kayakingadventures #kayaking #wildernesssystems #perceptionkayaks |
Apr 13 |
Social |
Instagram |
A bunch of bass caught tonight!#bass #bassfishing #largemouth #largemouthbass #lake #lakelife #fishing #fishon #fish #lifestyle #kayak #kayaking #kayakangler #kayakfishing #catchoftheday #catchandrelease #nature #spring #springfishing #selfie #addiction #rippinlips #bentrods #chatterbait #bassmaster #wildernesssystems #thetugisthedrug #thegreatoutdoors |
Apr 13 |
Social |
Instagram |
Keep an eye on the lower left. Fiesty lil pic! The action was nonstop tonight! #largemouth #largemouthbass #fishing #bassfishing #lifestyle #nature #spring #springfishing #myaddiction #cantstopwontstop #videooftheday #kayaking #kayakangler #kayakfishing #kayak #bassmaster #wildernesssystems #thetugisthedrug #thegreatoutdoors #catchoftheday #catchoftheday #rippinlips #bentrods #lake #lakelife #chatterbait #fun |
Apr 13 |
Social |
Instagram |
ready for new adventures, who's down? - #wildernesssystems #wildernessculture #kayaking #kayakfishing #jeep #outdoors |
Apr 13 |
Social |
Instagram |
Listen to those frogs! ° Perfect day on the water. Feeling one with nature. . . . . . #explore #explorewisconsin #kayaklyfe #lifeisgood #wildernesssystems #lifeofadventure #outdoors #thegreatoutdoors #onthewater #boat #imonaboat #liveauthentic #livesimply #kayak #kayaking @wildernesssystems #iphone7 #daytripper #carlislepaddles #createexplore #liveauthentic #kayaklife #paddleliving |
Apr 13 |
Social |
Instagram |
Made a new dog-deck for#hisfluffiness on the #tsunami145 Pretty sure he's going to love it! #paddleday #wildernesssystems #kayaking |
Apr 13 |
Social |
Instagram |
On the James River under the CSX A-Line bridge. #rva #kayakingadventures #kayaking #wildernesssystems #virginia |
Apr 13 |
Social |
Instagram |
It'll take more than a grey day to keep me away! . . . . #explore #explorewisconsin #blackotterlake #lifeisgood #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #boat #imonaboat #liveauthentic #livesimply #kayak #kayaking #kayaklife @wildernesssystems #olympusomdem5 #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving #paddlescene |
Apr 12 |
Social |
Instagram |
So I guess leaving the coast isn't so bad when we have a river like this to kayak on. #hillsboroughriverstatepark #kayaking #wildernesssystems |
Apr 12 |
Social |
Instagram |
Virginia Key stop always gives a great shot of Downtown Miami across Biscayne Bay #FLATkayak #florida #adventure #touring #kayak #kayaking #miami #southflorida #downtownmiami #virginiakey #biscaynebay #portofmiami #gopro #wildernesssystems #zephyr160 |
Apr 12 |
Social |
Instagram |
Kayaking Saluda River with my little sister. It was her first time and she is obviously a natural adventurer. #kayak #wildernessculture #wildernesssystems #adventure #stayoutside #saludariver #southcarolina #family #kayaking #shesanatural #outdoors #onthewater |
Apr 12 |
Social |
Instagram |
Watch as Ian explains the benefits of the @wildernesssystems NEW Helix pedal drive on our demo kayak! Come try it out for yourself on our lake today! |
Apr 12 |
Social |
Instagram |
First day out kayaking of the year, couldn't have asked for a better one! ☀️☁️ * * * #kayaking #sunnyday #lakecochituate #outdoors #outside #getoutside #optoutside #goeast #wildernesssystems #kayak #lake #photo #photooftheday #picoftheday #in2nature #keepitwild #neverstopexploring #lifeofadventure #blueskies #sunset #sunshine #spring #springday #explore #exploremore #adventure #roamtheplanet #nofilter #nofilterneeded @easternmntnsports @wildernesssystems @pineandwater @ig_massachusetts @massachusettsoutdoors |
Apr 12 |
Forums |
/r/Kayaking |
Choosing kayak hull material |
Apr 12 |
Social |
Instagram |
Committing to paddling a lot more, smiling more and breathing deeper. Day 2 . . . . . #explore #explorewisconsin #blackotterlake #chainolakes #lifeisgood #wildernesssystems #tsunami140 #lifeofadventure #outdoors #thegreatoutdoors #onthewater #boat #imonaboat #liveauthentic #livesimply #kayak #kayaking #kayaklife @wildernesssystems #olympusomdem5 #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving |
Apr 12 |
Social |
Wilderness Systems Fishing Kayaks FB |
Follow YakFish TV Robert Field in his ATAK 140 and Bert and Dan Rodriguez on the redemption trip of a lifetime down the wild and beautiful Pecos River in Southwest Texas. Watch PART 3 of Surviving the Pecos at the LINK HERE: http://bit.ly/ReturnToPecos_PartThree #wildyfishing |
Apr 12 |
Social |
Wilderness Systems Fishing Kayaks FB |
5 Tactics from pro staffer Drew Haerer that put big bass in the kayak when the ice starts melting. #wildyfishing http://www.wildernesssystems.com/us/experience/team-blog/297/post/five-ice-out-lures-and-techniques-catch-big-bass |
Apr 12 |
Social |
Instagram |
Paddle Day 2 . . . . . #explore #explorewisconsin #waupaca #chainolakes #lifeisgood @patagonia #wildernesssystems #lifeofadventure #outdoors #thegreatoutdoors #onthewater #boat #imonaboat #liveauthentic #livesimply #kayak #kayaking @wildernesssystems #iphone7 #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving |
Apr 11 |
Social |
Instagram |
No hogs today but still caught a bunch of bass! #bass#bassfishing #bassmaster #largemouth #largemouthbass #fishon #fish #catchoftheday #catchandrelease #selfie #fishing #freshwater #freshwaterfishing #angler #fisherman #nature #thegreatoutdoors #thetugisthedrug #lake #lakelife #kayak #kayaking #kayakangler #kayakfishing #wildernesssystems #picoftheday #rippinlips #bentrods #fishon |
Apr 11 |
Social |
Instagram |
Kayaked 14miles yesterday on the Mulberry and I am feeling it today!!! #yeti #yeticoolers #yetiroadie #tarpon100 #kayaking #yaklife #yakaddicts #wildernesssystems #adventure #adventuretime #adventures #kayak #kayakingadventures #mulberryriver #corebrewery #nature #natureporn #natureaddict #fun |
Apr 11 |
Social |
Instagram |
Peanut butter and jelly. Get it? #oakisland #paddlefaster #wildernesssystems #water #springbreak2017 #jellyfish #lowtide #kayaking #kids |
Apr 11 |
Social |
Instagram |
Exactly two years I took my sea kayak for a spin. Some sort of jellyfish about. Have been whitewater kayaking over 13 years now. Time flies... Certainly am getting grey hairs now ° @wildernesssystems #seakayaking #seakayak #kayaking #kajak #kayak #kayakingislove #capetownmag #lovecapetown #westcoast |
Apr 11 |
Social |
Instagram |
The fun kids of Oak Hill School on the Chetco. #wildernesssystems #kayaking #SCT #xcelwetsuits |
Apr 11 |
Social |
Instagram |
#kayaking #kayakingflorida #florida #swfl#marcoisland #tenthousandislands #pictureoftheday #sundayfunday #wildernesssystems #valleykayaks |
Apr 11 |
Social |
Instagram |
I feel truly addicted to fishing.Its always on my mind. I'll do it in the rain, the heat, the cold and the wind. I guess there's worse things to be addicted to!#fishing #freshwaterfishing #bassfishing #kayakfishing #kayakangler #kayaking #kayak #wildernesssystems #picoftheday #catchandrelease #rippinlips #bass #largemouth #largemouthbass #spring #springfishing #nature #thegreatoutdoors #thetugisthedrug #bentrods #fishon #fish #lake #lakelife #addiction #hobbies #lifestyle |
Apr 11 |
Social |
Instagram |
The other Oak Hill school crew on the Chetco. These guys braved a little early rain while maintaining good attitudes. #xcelwetsuits #wildernesssystems #thepeoplescoast #traveloregon #SCT #kayaking |
Apr 11 |
Social |
Instagram |
When brewers go kayak camping, we pack a corny keg. . . . . . . #explore #explorewisconsin #discoverwisconsin #lifeisgood #beer #drinkwisconsinbly #kayakcamping #wildernesssystems #lifeofadventure #outdoors #thegreatoutdoors #onthewater #boat #imonaboat #liveauthentic #livesimply #kayak #kayaking @wildernesssystems #iphone7 #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic #kayaklife #paddleliving |
Apr 10 |
Social |
Instagram |
Paddle practice! (I may have fallen in) #kayaking #parklake #dogonaboat #sundayfunday #newkayak #wildernesssystems #tsunami145 |
Apr 10 |
Forums |
NorCal Kayak Anglers |
Re: GS11 - 5/20/17 - Thank you, Wilderness Systems! Radar 135 and Paddle for raffle! |
Apr 10 |
Social |
Instagram |
My smallest bass from yesterday but he still has my respect appreciation! #bass #bassfishing #largemouth #largemouthbass #thetugisthedrug #fishing #freshwaterfishing #catchoftheday #catchandrelease #picoftheday #thegreatoutdoors #spring #nature #kayak #kayaking #kayakangler #kayakfishing #bentrods #tightlines #rippinlips #selfie #fish#fishon #bassmaster #wildernesssystems |
Apr 10 |
Social |
Instagram |
Join us on April 22 for our Earth Day Demo Day event in Morro Bay @ Coleman Beach. Try before you buy! #prokayakfishing #centralcoastkayaks #wildernesssystems #jacksonkayak #vibekayaks |
Apr 10 |
Social |
Instagram |
Another April paddle. . . . . . #explore #explorewisconsin #waupaca #chainolakes #lifeisgood @lifeisgoodco #wildernesssystems #lifeofadventure #outdoors #thegreatoutdoors #onthewater #boat #imonaboat #liveauthentic #livesimply #kayak #kayaking @wildernesssystems #iphone7 #daytripper #carlislepaddles #olympustough #createexplore #liveauthentic |
Apr 9 |
Social |
Instagram |
It's been a long day of paddling and enjoying gods gifts. A much needed day of relaxing was a success. #forgottencoast #kayaking #kayakfishing #panacea #livelifeoutdoors #gulfofmexico #wildernesssystems #adventuretechnologypaddles #pennfishing |
Apr 9 |
Social |
Instagram |
Great day today at our Fishing Kayak Demo Day at the John E. Pechmann Fishing Education Center in Fayetteville, NC. Thanks to all who came out! Looking for a unique, family-oriented fishing experience? Come visit the John E. Pechmann Fishing Education Center in Fayetteville, N.C. Built in 2007, the Pechmann Center is the N.C. Wildlife Resources Commission’s newest education facility and is the only fishing education center of its kind in North Carolina. Center instructors teach a variety of aquatic programs to anglers of all ages and abilities. #hooklineandpaddle #pechmannfishingeducationcenter #fayettevillenc #kayakfishing #fishingkayak #fishing #education #ncwildlife #demoday #kayakangler #bassfishing #nativewatercraft #wildernesssystems #jacksonkayak @christryonhlp |
Apr 9 |
Social |
Instagram |
Trying out the pedal drive! @yaktribe @sh_ne @wildyfishing #yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #sundays #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #wildernesssystems #Wildyfishing |
Apr 9 |
Social |
Instagram |
Even if you're not looking to buy a new kayak or paddleboard, get to Lake Julian before 2:00 to paddle our demo fleet for FREE on a stunningly perfect spring day! #adventureislocal #diamondbrandoutdoors #lakejulian #water #paddle #kayak #kayaks #kayaking #sup #paddleboarding #standuppaddle #828isgreat #avl #free #asheville #ashevillenc #arden #buncombecounty @liquidlogickayaks @nrsweb @wildernesssystems @astralfootwear @chacofootwear @keen @nativewatercraft @hurricanekayaks @wernerpaddles |
Apr 9 |
Social |
Instagram |
Introducing #ariakayaks Follow us to watch our favorite 3y/o #littleadventurer explore and conquer the world, one paddle at a time. :) #isthiskayakgoingaroundyet? #kayaking #spacecoast #brevard #orlando #letsgo #haulovercanal #manatees #dolphins #bioluminescence @wernerpaddles do you make a paddle for someone 36inches tall? ° @wildernesssystems you got a booster seat for a pamlico? |
Apr 9 |
Social |
Instagram |
It has arrived! The long anticipated Helix Pedal Drive, a drop in for the Wilderness Radar 115 & 135. If you have been waiting for one, come on in! . . . . . . . . #canoecountryfl #ccofl #wildernesssystems #helixpd #pedaldrive #radar #kayak #kayaking #kayakfishing #paddling #stpete #tampabay #florida |
Apr 9 |
Social |
Instagram |
Kai-yaking #kayaking #wildernesssystems #outdoors #northoconeeriver |
Apr 9 |
Social |
Instagram |
Kayaking and birding the Yadkin River today. We found 50 species over 16.3 miles #kayaking #wildernesssystems #garmin #nc #winstonsalem #yadkinriver #birding |
Apr 8 |
Social |
Instagram |
#kayak #kayaking #kayakfishing #penn #shakespear #wildyfishing #wildernesssystems #ride135 #ray #dogfish #whiting #barry #coldknap #southwales #uk #summersday #daysout #fun #paddling #friends |
Apr 8 |
Social |
Instagram |
How do you haul your yak? #campingwithmykayak #camping #optoutside #getoutthere #kayaking #ipadventures #xterra #wildernesssystems #generaltires |
Apr 8 |
Social |
Instagram |
Kayaking the deep river,nc river is super high. Only place to stop was under a bridge. Live that hobo life! #kayak #kayaking #wildernesssystems #ncriver #nc #albanyohd #onnit #getonnit #cavemancoffee #cavemancoffeeco #killthequit #killcliff #lifegoals #argylestyle #bigheadgym |
Apr 8 |
Social |
Instagram |
Bring a dog, bring a friend. Bring someone you love, bring someone you hate. Just make sure you make it to Lake Julian on Sunday to try out our kayaks + SUPs! #adventureislocal #lakejulian #kayak #sup #paddleboarding #kayaks #kayaking #828isgreat #lake #sundayfunday #outdoors #diamondbrandoutdoors @liquidlogickayaks @nativewatercraft @hurricanekayaks @nrsweb @wildernesssystems @wernerpaddles @astralfootwear @chacofootwear @keen |
Apr 8 |
Social |
Wilderness Systems Kayaks FB |
Wilderness Systems Kayaks updated their profile picture. |
Apr 8 |
Social |
Wilderness Systems Kayaks FB |
Wilderness Systems Kayaks updated their cover photo. |
Apr 8 |
Social |
Instagram |
Let the protein bar and kayaking season begin... Macros: Cal 200/Carb 23 g/Fat 7g/Pro 21g #simplefitfood #simplefitfoods #macroswithjen #pureprotein #kayaking #protein #wildernesssystems #summer |
Apr 7 |
Social |
Instagram |
What a wonderful spring day to unload some @wildyfishing @wildernesssystems and @perceptionkayak kayaks. The best part, now the @bluwavesup shipment has also arrived! #kayaks #standuppaddleboards #goretexiswonderful |
Apr 7 |
Social |
Instagram |
Hello Friday! Hello weekend! Hello adventure! We are obviously excited to see you... #wildernesssystems #kayak #kayaking #welcomeweekend #weekend #weedonisland #fun #funnyfaces #funnyface #adventure #adventuring #explore #outdoors #outdoor #florida #exploreflorida #tampabay #saltlife #enjoylife |
Apr 7 |
Social |
Instagram |
Bass on Frogger Bomber Fly tied by Johnny Martinez / www.johnnyonthefly. #flytying #lakeathens #bassonthefly #flyfishing #flyfishingaddict #onthefly #topwaterbite #rioflylines #tfomangrove #orvissouthlake #fortworthflyfishers #backwoodsfortworth #imkmark #jstockard #lumixgh3 #repyourwater #keepemwet #redingtongear #wildernesssystems #kayakflyfishing #kayakbassfishing #pakpod #wernerpaddles |
Apr 7 |
Social |
Instagram |
Miss you baby °°°° see you soon #paddle #paddlelakedillon #cravingkayaks #wildernesssystems #kayaking #lakedillon #summitcounty |
Apr 6 |
Social |
Wilderness Systems Fishing Kayaks FB |
Watch Part 2 of 'Surviving the Pecos River' with Robert Field of YakFish TV as they take on another leg of this bucket list fishing expedition. Watch the full length VIDEO HERE: https://goo.gl/jjG3EN #atak140 #wildyfishing |
Apr 5 |
Social |
Instagram |
Inauguration Day for the RADAR 135. In enjoying how it paddles and handles thus far. Plenty of stability for sight casting. #wildyfishing #wildernesssystems #radar135 #pennreels #uglystik #gulp #bendingbranches #obx #kayaking #kayakfishing |
Apr 5 |
Social |
Instagram |
It's been a while since I've been able to get out on the water but finally made it out again and went to one of my favorite spots, Chicken Key #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #paddling #paddlemixtape #outdoors #outdoorlife #islandlife #winter #wildernesssystems #gopro #howtodoflorida #kayakgram #kayaklyfe #lowtide #zephyr160 #biscaynebay #miami #miamilife #chickenkey |
Apr 4 |
Social |
Wilderness Systems Fishing Kayaks FB |
Wilderness Systems Fishing Kayaks updated their profile picture. |
Apr 4 |
Social |
Instagram |
The put in spot at Wolfpen this weekend!! #kayaking #kayak #yaklife #mulberryriver #adventure #adventures #kayakgram #kayakingadventures #kayaklove #wildernesssystems #tarpon100 #jacksonkayak #vibekayaks #jacksoncoosa #yellowfin100 #nature #naturelovers #natureporn #whitewater #rapids #theozarks #thewoodsman #yakaddicts #fayettechill #outdoors #outdoorlife #fun |
Apr 4 |
Social |
Instagram |
New YouTube video in the works! Helix peddle drive unboxing. °°#yaktribe #yaktribetexas #yakfishing #fishing #kayak #yakangler #paddle #sundays #kayakfishing #kayaking #lonestarstate #texaskayakfishing #hook #wildernesssystems #Wildyfishing #helixpeddledrive |
Apr 4 |
Social |
Wilderness Systems Fishing Kayaks FB |
Watch and learn how Jeff Little of Tightline Junkie Journal consistently catches huge stripers from his kayak! VIDEO LINK: https://tightlinejunkiejournal.pivotshare.com/media/early-spring-shallow-water-stripers/60477/preview |
Apr 4 |
Social |
Wilderness Systems Fishing Kayaks FB |
In this episode, Chad Hoover teams up with Gene Jensen to host a kayak bass fishing seminar at Florida’s legendary Bienville Plantation. The Sportsman Channel #knotrightkayakfishing #kayakbassin #KBF See AIRING SCHEDULE here: https://goo.gl/Lg4bao |
Apr 4 |
Social |
Instagram |
Got my ass handed to me today but still pulled out a slam by 10am! Talk about a mouth full!! . . . #mirrolure #catchjr #snook #kayakfishing #flatsfishing #saltwaterexperience #windy #smallcraft #kayaking #flatsfishing #atak140 #wildernesssystems #yakanglers #yakattack |
Apr 3 |
Social |
Instagram |
Picking wild blackberries from the yak. #kayakfishing #kayaking #wildernesssystems #kayak |
Apr 3 |
Social |
Instagram |
#sundayfunday #chaconation #kayaking #kayakingadventures #camping #hiking #At17workout #sectionhikeworkout #wildernesssystems #justdoit #optoutside #outdoors |
Apr 3 |
Forums |
NorCal Kayak Anglers |
Re: Viking Reload |
Apr 3 |
Social |
Instagram |
#kayak #kayaking #tarpon120 #wildernesssystems |
Apr 3 |
Social |
Instagram |
Lil' man tracking' like a pro. I think he's hooked. #lakehickory #kayaking #relax #weekends #wildernesssystems #oldtownkayak #familytime #novideogames #outdoorliving #prouddad |
Apr 3 |
Social |
Instagram |
Hello gorgeous Arizona weather! Took the kayak and SUP out today for the first lake day of the year! . . #lindsirianphotography #arizonaphotographer #adventurephotographer #outdoorphotographer #landscapephotographer #utahphotographer #coloradophotographer #pnwphotographer #caphotographer #nationalparkphotographer #explore #adventure #getoutdoors #optoutside #rei1440project #whatsyour20 #adventurous #roadtrip #nature #keepitwild #SUP #wildernesssystems #advancedelements #suparizona #canyonlake #tortillaflat #arizona |
Apr 2 |
Social |
Instagram |
Awesome day for a Demo Day! Big thanks to all who came out today! #hooklineandpaddle #demoday #fishingkayak #kayakfishing #bassfishing #fishing #kayakangler #kayak #kayaking #paddleboarding #paddleboard #fishingpaddleboard #wilmingtonnc #inshorefishing #offshorefishing @christryonhlp @02seedoc #nativewatercraft #liquidlogic #wildernesssystems #perceptionkayaks #jacksonkayak #yoloboard #livewatersports #soloskiff #astral #accentpaddles #immersionresearch #boonedoxusa #capefearelements #drycase #surfershealingnorthcarolina |
Apr 2 |
Social |
Wilderness Systems Fishing Kayaks FB |
Watch our friend Robert Field from YakFish TV style it in the A.T.A.K. 140 in the epic Return to the Pecos - Part One: http://bit.ly/ReturnToPecos_PartOne PS - we're pretty sure Robert said that the A.T.A.K. was the only kayak not to turtle through the rapids. #WildyFishing |
Apr 2 |
Social |
Wilderness Systems Fishing Kayaks FB |
Over 300 kayak anglers at the KBF National Championship captains meeting lastnight. Who's taking home the $35,000 win? |
Apr 2 |
Social |
Instagram |
The mulberry was a flowin' this weekend!!!! #mulberryriver #kayaking #yaklife #getoutside #adventure #adventures #kayak #whitewater #nature #natureporn #naturelovers #natureaddict #fayettechill #thewoodsman #kayakgram #wildernesssystems #tarpon100 #vibekayaks #jacksonkayak #kayakcamping #floating #floattrip #fun #theozarks #ozarks #kayakingadventures #yeti |
Apr 2 |
Social |
Instagram |
Took off at Loosier Lake yesterday in the #ride115x and #tarpon100 from @wildernesssystems - and had a pretty great day minus the extreme sunburn we endured.#kayaking #kayaks #kayakfishing #kayakbassfishing #bass #bassfishing #backwaters #fishing #alabamafishing |
Apr 1 |
Social |
Instagram |
SHOP TOUR: Stop by Saturday, April 1st and check us out for huge storewide savings on kayaks, fishing kayaks, paddleboards, and gear! Demo day at Smith Creek County Park from 11am-3pm. #hooklineandpaddle #shoptour #fishingkayak #kayakfishing #bassfishing #fishing #kayakangler #kayak #kayaking #wilmingtonnc #inshorefishing #offshorefishing @christryonhlp #beachlife #nativewatercraft #nativewatercrafttitan #liquidlogic #wildernesssystems #wildyfishing #perceptionkayaks #daggerkayaks #jacksonkayaks #jacksonkayak #yoloboard #yolo #livewatersports #soloskiff #shoplocal |
Mar 30 |
Forums |
/r/Kayaking |
Who says you can't have a kayak in an apartment? My new Wilderness Systems Pungo 140. |
Mar 29 |
Forums |
/r/Kayaking |
Aspire 105 worth it? |
Mar 26 |
Forums |
/r/kayakfishing |
I found a great deal on craigslist so made the purchase. |
Mar 26 |
Social |
Instagram |
We had a great day at the Mid-Ohio Valley Sportsmans expo! Even got to share my love of kayak fishing through a seminar! Best of all, we saw several men make decisions to follow Christ! Thanks to all the vendors and volunteers who helped make this event a success! #mska #kayakbassin #kayak #kayakfishing #kayakangler #kayakangling #midohiovalley #sportsman #expo #seminar #outreach #fishing #outdoors #ministry #follow #teach #klmworms #wildernesssystems #jacksonkayak #mariettaadventurecompany #greatoutdoors |
Mar 25 |
Social |
Instagram |
Just another day of paddling for Biscuit the Adventure Dog °. . . . . . #thevacationmachine #LiveRiveted #MyLiveRivetedLife #airstream #airstreamsafari #GoRVing #rv #camping #GetOutside #Wanderlust #goprohero5 #kayaking #kayakingkids #kayakingdog #campingdog #littleredriverar #rockmonkeyoutfitters #jacksonkayaks #wildernesssystems |
Mar 25 |
Social |
Instagram |
Tea Break! Perfect conditions on Lake Windermere yesterday. Spent the whole day been buzzed by jets! #kayaking #kayak #jetboil #lakedistrict #windermere #lakes #lakeland #ambleside #wildernesssystems |
Mar 25 |
Social |
Wilderness Systems Kayaks FB |
HELP our Research & Development efforts by taking a quick 7 question survey about your paddling trips! SURVEY: https://www.surveymonkey.com/r/Z3BBQ79 |
Mar 25 |
Social |
Instagram |
Ingulka river Kherson Region Ukraine #wildernesssystems #wernerpaddle #kayaking #rest_in_kherson |
Mar 25 |
Social |
Instagram |
Thanks Nancy and family for going #kayaking with #blazinpaddles today. #beauty #beautifulweather #beautiful #blackcanyon #blazinpaddlestour #iphone #gopro #lasvegas #offthestrip #mercedes #aquabound #wildernesssystems #hooverdam #willowbeach #emeraldcave |
Mar 25 |
Social |
Instagram |
Summer come soon °°#taylorreservoir #wildernesssystems #kayaking #happyplace #summer #coloradoskies #colorado |
Mar 24 |
Social |
Wilderness Systems Fishing Kayaks FB |
The highly anticipated Helix PD™ Pedal Drive has officially launched! Arriving soon to a Wilderness Systems dealer near you. https://goo.gl/tBZ8qc |
Mar 24 |
Social |
Instagram |
It was a LONG day, but it ended great! Let the rigging begin. #wildyfishing #radar135 #atak120 #kayak #kayaking #kayakfishing #fishing #paddle #wildernesssystems #midnight #boat #boats #plastic |
Mar 24 |
Videos |
Youtube |
RAM Totalscan Transducer Arm Install on Kayak |
Mar 23 |
Social |
Instagram |
Thinking back to last summer. First day on the water in the new boat. Hard to forget that first fish. #kayakfishing #wildyfishing #fishing #northernpike #wildernesssystems #wernerpaddles |
Mar 23 |
Social |
Instagram |
LIVRAISON SPÉCIALE: Les kayaks @DaggerKayaks @WildernessSystems @PerceptionKayak sont arrivés en magasin ce matin! #KayakQuébec #Kayaks #Kayaking #WildernessKayaks #PerceptionKayaks #DaggerKayaks #Kayak #QuébecKayak |
Mar 23 |
Social |
Instagram |
Always hard to be at work when you know you got one shift left before a whole weekend on the lake. Shasta bound tomorrow! #hobie #wildernesssystems #icouldntpickaboat #dobynsrods #lewsreels #charmerbaits #fishermansheadquarters #wishinitwaskentuckylake #gopro #nrs #wernerpaddles #lowrance |
Mar 22 |
Social |
Instagram |
#romega #georgiasrome #exploregeorgia #wandernorthga #etowahriver #OptOutside #roamwithlions #wildernesssystems #tarpon100 #kayaking #riverlife #riverrat #getoutsidegeorgia #werner #northgatreks #getoutside #wildernessculture #fiftyshades_of_nature #myhappyplace #thegoodlife #discovering_captures |
Mar 22 |
Social |
Instagram |
Hook, Line & Paddle's Annual Spring Demo Day Saturday, April 1st from 11-3 at Smith Creek Park in Ogden. Try different kayaks, fishing kayaks, pedal kayaks, paddleboards, & fishing paddleboards! Come try before you buy! Big Thanks to New Hanover County Parks! #hooklineandpaddle #demoday #newhanovercountyparks #kayak #paddleboard #sup #fishingkayak #nativewatercraft #liquidlogic #jacksonkayak #wildernesssystems #perceptionkayaks #yoloboard #yolo #livewatersports #live2fish #thule #astral #accentpaddles #drycase #boonedox #orioncoolers @nhcparks @wectnews @frances.weller @wwaynews @starnewsonline @christryonhlp #smithcreekpark #wrightsvillebeach #figure8island #carolinabeach #portersneck #fayettevillenc |
Mar 22 |
Social |
Instagram |
Ooh la la! Our boat room is full! We have boats in a variety of sizes, colors, and purposes and they are ALL looking for a good home. Get your boat and gear and get ready to paddle - spring is here! #paddlefxbg #kayaks #kayakfishing #kayakadventures #getoutside #letthegoodtimesflow #riverlife #jacksonkayak #wildyfishing #wildernesssystems #dagger |
Mar 22 |
Social |
Instagram |
Yes afternoon was so beautiful the whole BE team @rvmetalshop @ekspottery @stacicripps @guilded_tongue skipped out to go kayaking! We truly have the most incredible team!!! Nothing like a little time on the water to reset. #kayakingfun #kayaking #exploregeorgia #wildernesssystems #thelakeiscalling #georgia #wandernorthga #beoutside #optoutside #optoutdoors |
Mar 22 |
Social |
Instagram |
Spring break and 80 degree weather means jumping in the kayak for an early spring paddle! °☉ #kayak #paddle #yakattack #wernerpaddles #wildernesssystems |
Mar 22 |
Social |
Instagram |
Trinity River Bass on the Fly #fortworthflyfishers #txflyfishingfestival #trinityrivervision #onthefly #kayakflyfishing #kayakbassfishing #kayakbassfishingmagazine #lumixgh3 #wildernesssystems #largemouthbass #orvissouthlake #tfomangrove #wernerpaddles #streamerflyfishing #catchandrelease #trinityriverfortworth #backwoodsfortworth #flyfishing #thetugisthedrug #fishporn |
Mar 22 |
Social |
Instagram |
Once this snow and ice melts I'll be back on the water hunting big bass, can't wait!#wildernesssystems #kbf #yakattack #yakaddicts #powerpole #kayakbassfishing #kayakfishing #bassmaster #bassfishing #bassuniversity #kokatat #freshwaterfishing #kayaktournamentangler #bassfish #fishing #fishinglife #ikelive |
Mar 22 |
News |
Kayak Angler Magazine |
Three Tips To Mastering Your Fishing Bait |
Mar 20 |
Social |
Wilderness Systems Fishing Kayaks FB |
Exclusive and free access to the latest issue of Kayak Angler magazine. Spring 2017 copy available now at the link below. https://www.rapidmedia.com/kayakangler/categories/news/8488-issue-preview-spring-2017 |
Mar 18 |
Forums |
/r/kayakfishing |
Wilderness Systems Ride 135 |
Mar 17 |
Videos |
Youtube |
Wilderness Systems Tarpon 120 kayak |
Mar 16 |
Forums |
/r/kayakfishing |
Wilderness Systems Radar 115 |
Mar 15 |
Social |
Wilderness Systems Fishing Kayaks FB |
Pro Rig your Radar 135 into a fully tri-powered yak. Capable of efficiently switching between power modes for any fishing scenario. http://www.wildernesssystems.com/us/experience/team-blog/297/post/jeff-little-maiden-voyage-and-rigging-radar-135 |
Mar 14 |
Social |
Instagram |
Emerald waters.#kayaking #westernaustralia #ocean #mainpeak #wildernesssystems #tsunami #sea |
Mar 13 |
Social |
Instagram |
Small lake. 7-10lb bag is good. #fish #fishing #bassfishing #panfishing #largemouth #largemouthbass #blackbass #crappie #blackcrappie #shimano #pline #ownerhooks #yamasenko #filthy #filthyanglers #certifiedfilthy #columbiasportswear #uafish #wildernesssystems #tarpon120 #kayak #kayaking #kayakfishing fishing #alhambra #antioch |
Mar 13 |
Social |
Instagram |
Does your tandem partner leave you #paddling solo like my little buddy did here? #islandboys #jossandemit #wildernesssystems #stohlquist #paddlingwithkids #kayakgram_feature #kayaking |
Mar 13 |
Social |
Instagram |
Don't forget to take a friend to the great outdoors!!! Get out there!!! #kayaking #camping #gopro #motivation #pnw #thetimeisnow #paddlelife #paddle #wildernesssystems |
Mar 13 |
Social |
Instagram |
(Swipe left to view all pics) Chris Tryon and Michael Snyder setting up for today's Kayak Showcase & Seminar at Porter's Neck Plantation & Country Club Recreational Center. Thank you so much for the invitation and hospitality! We look forward to paddling with y'all! #hooklineandpaddle #portersneck #portersneckcountryclub #wilmingtonnc #kayak #kayaking #kayakfishing #fishingkayak #familyfun #lovewhereyoulive #guestspeaker #nativewatercraft #liquidlogic #wildernesssystems #jacksonkayak #perceptionkayaks #daggerkayaks @christryonhlp |
Mar 12 |
Social |
Instagram |
Kayaking is my happy place. #kayak #kayaking #happyplace #wildernesssystems |
Mar 12 |
Social |
Instagram |
#paddling #8miles #townlake in my #beautiful #hometown #austintexas #stohlquist #mammut #wernerpaddles #wildernesssystems #ackvibes @austin_kayak @roguexpeditions @stohlquistwaterware |
Mar 12 |
Social |
Instagram |
Morning on the water at Lake Powell °°#livesimply #ownlessstuff #liveyouradventure #coupleswhotravel #camper #nomad #lifeontheroad #happycamper #camp4pics #in2nature #ourcamplife #keepitwild #wearestillwild #morningscenes #morningslikethese #vscoedit #lifewelltraveled #travelandlife #kayakfishing #kayaking #wildernesssystems |
Mar 11 |
Social |
Instagram |
Still with a high of 56...It's gonna be chilly on the water today. #kayaking #kayak #scstateparks #wanderlust #discoversc #exploresc #cherawstatepark #lakelife #wildernesssystems #weather #southcarolina |
Mar 11 |
Forums |
/r/Kayaking |
Newbie looking for advice (Bois Brule River, WI) |
Mar 11 |
Social |
Instagram |
Saturday paddle out around Budd Keys on our way to Tarpon Belly Key. #florida #floridakeys #kayaking #wildernesssystems |
Mar 10 |
Social |
Instagram |
Setting up for tonight's kayak fishing seminar by Chris Tryon at the Compass Pointe Community Fishing Club Meeting. Thanks for the invite and hospitality Joe! #hooklineandpaddle #compasspointe #compasspointenc #lelandnc #kayakfishing #kayak #fishing #fishingclub #resortliving #nativewatercraft #jacksonkayak #wildernesssystems #liquidlogic #perception #yoloboard #yolo #live2fish #soloskiff #fishinglife #lovewhereyoulive |
Mar 10 |
Social |
Instagram |
Where are you setting up camp this weekend? Get out there!!! #getoutthere #ipadventures #gofsr #getoutside #xterra #kayaking #wildernesssystems #hiking #climbing #optoutside #overland #adventure #adventuretravel #adventuretrailer |
Mar 10 |
Social |
Instagram |
It's a Beautiful day for a Paddle!!°°: @jason_hoss Located @robbiesofislamorada #kayakshack #bucketlist #thingstodo #islamorada #flkeys #floridakeys #floridakeyskayak #keyslife #views #saltlife #southflorida #soflo #islandlife #islamoradatimes #beautifuldestinations #kayaklife #perceptionkayaks #wildernesssystems #adventure #bendingbranches #kayaks #kayaktour #kayaking |
Mar 9 |
Social |
Wilderness Systems Kayaks FB |
Your feedback helps us make customized product designs and stay at the forefront of kayak innovation and quality. Let us know what you want by taking this six question survey. Thank you for your support! http://survey.constantcontact.com/survey/a07edw6l9f3izst8h7v/start |
Mar 9 |
Videos |
Youtube |
Alligator Gar Busts Through Net - EPIC Kayak Fishing Day Wilderness Systems ATAK 140 |
Mar 9 |
Social |
Instagram |
°°° - - - @wernerpaddles @wildernesssystems @kayakgram #latepost #wednesday #yesterday #river #kayak #florida #wild #spring #paddle #fl #getoutstayout #nature #pic #neverstopexploring #outdoors #kayaking #boat #nomad #chilly #water #blue #springs #latergram #potd #thegreatoutdoors #travel #photo #getoutside #kayaklife #latergram |
Mar 9 |
Forums |
/r/kayakfishing |
Looking for opinions on my first fishing kayak. |
Mar 9 |
Social |
Instagram |
SCT is so stoked to have 3 smart and powerful women guides in 2017! #SCT #thepeoplescoast #kayaking #oceankayak #traveloregon #wildernesssystems #hobiesup #nrs |
Mar 9 |
Social |
Instagram |
No rack and a soft top..... pool noodles and a couple ratchet straps will get er home! Yes, a rack is in my future! My new #wildernesssystems Tarpon 120 sit on top kayak, can't wait ! #jeep #jeepwrangler #jku #lakestclair #kayaking |
Mar 8 |
Social |
Instagram |
2017 boats have arrived. #perceptionkayaks #daggerkayaks #wildernesssystems #fatjimmysoutfitters #kayak #kayaking #kayakfishing |
Mar 8 |
Social |
Instagram |
Eat.Sleep.Paddle.Repeat #ichetuckneeriver #ichetucknee #springs #florida #naturalflorida #naturalresource #saveoursprings #freshwater #paddle #kayak #river #necky #neckykayaks #wildernesssystems #wildernessystemskayaks #werner #wernerpaddles #adventure #optoutside #getoutside #nature #happyplace #adventure #adventureiswaiting #sunshine #sunshinestate #riverrats #aquaticnomad #rivertramp #drifter |
Mar 7 |
Social |
Wilderness Systems Fishing Kayaks FB |
Take this 6 questions survey from our R&D team and tell us what you want on the water. Thank you for your support! http://survey.constantcontact.com/survey/a07edw6l9f3izst8h7v/start |
Mar 6 |
Social |
Instagram |
Can't wait to get back on the water! . . . . . . . . #liveauthentic #travel #adventurethatislife #wisconsin #adventure #vanlife #projectvanlife #kayak #kayaking #wildernesssystems #bendingbranches #lifeisgood @wildernesssystems #photooftheday #adventurevisuals #photography |
Mar 6 |
Social |
Instagram |
Find you beach!!! #lookwhatifound #ipadventures #canon #camping #wildernesssystems #beachlife #gofsr #kayaking |
Mar 6 |
Social |
Wilderness Systems Fishing Kayaks FB |
Your feedback helps us make customized product designs and stay at the forefront of kayak innovation and quality. Let us know what you want by taking this six question survey. Thank you for your support! http://survey.constantcontact.com/survey/a07edw6l9f3izst8h7v/a001izybinkg/questions |
Mar 5 |
Social |
Instagram |
We kayaked at Alligator River today. Finally heard a Barred Owl in Dare County too. #kayaking #wildernesssystems #garmin #alligatorriver #obx |
Mar 5 |
Social |
Instagram |
After dinner paddle!!! #ipadventures #pnw #gofsr #kayaking #lakelife #wildernesssystems #optoutside #getoutthere |
Mar 5 |
Social |
Instagram |
Sexy beach photo shoot #FLATkayak #florida #adventure #touring #kayak #kayaking #outdoors #outdoorlife #paddle #paddling #paddlemixtape #kayakgram #kayaklyfe #keybiscayne #winter #wildernesssystems #america #atlanticocean #gopro #howtodoflorida #zephyr160 #biscaynebay #miami #miamilife #beach |
Mar 5 |
Social |
Instagram |
Ice on the Wenatchee river. #kayak #kayakninja #wildernesssystems #wenatcheevalley #wenatchee #wernerpaddles #wernerikilos #pnw #pnwlove #washingtonstate #paradise |
Mar 5 |
Social |
Instagram |
Excellent selections of #fishingkayak from @oexpointloma @oexsunstbeach and @oexmissionbay. #fredhallshow Long beach.. . #fishingkayaks #kayakfishing #kayaking #kayaker #paddlesports #kayak_fish #SUPsurf #supfishing #kayakstorage #perceptionkayaks #supstorage #oceankayak #oceankayaking #boatdock #waterfront #paddlesurf #fishingboat #flyfishing #supsurf #bassfishing #malibukayaks #wildernesssystems #fishinggear #fishingsupplies #fishingkayakstorage #lajollacove #paddleboarder #missionbay |
Mar 4 |
Social |
Instagram |
#happyfriday #friday #kayak #kayaking #BeaverLake #Rogers #rogersAR #RogersArkansas #Bentonville #BentonvilleAR #BentonvilleArkansas #NorthwestAR #northwestarkansas #paddlejunkies #perceptionkayaks #wildernesssystemskayaks #wildernesssystems #beautifulday |
Mar 4 |
Social |
Instagram |
#kayakninja #wildernesssystems #wenatcheevalley #wenatchee #wernerpaddles #wernerikilos #pnw #pnwlove #washingtonstate #paradise |
Mar 4 |
Social |
Instagram |
At the #portlandmaine Boat show repping #kitterytradingpost #wildernesssystems #oldtownkayak #kialoapaddles #surftech #wernerpaddles #yeticoolers #bicsup #standuppaddle #kayak #maine #summer |
Mar 4 |
Social |
Instagram |
Enjoying time on the water at Old Hickory above the dam in the Wilderness Systems Kayaks Zephyr Pro 155. What do you paddle? #wildernesssystemskayaks #HOOK1 #Kayak #Kayaking #Paddle #paddling #Paddlelife #Wildernesssystem #zephyr |
Mar 4 |
Social |
Instagram |
Biscayne Bay on one side and the Atlantic Ocean on the other #FLATkayak #florida #adventure #touring #kayaking #kayaking #paddle #paddling #wildernesssystems #winter #islandlife #outdoors #outdoorlife #paddlemixtape #gopro #howtodoflorida #kayakgram #kayaklyfe #zephyr160 #biscaynebay #atlanticocean #miami #miamilife #bearcut #bridge #keybiscayne #virginiakey |
Mar 3 |
Videos |
Youtube |
Kayak Outrigger Stabilizers |
Mar 3 |
Social |
Instagram |
Today is going to be an awesome day! Hope everyone has a great Friday! If you need me, Cash me on da lake ° #happyfriday #friday #kayak #kayaking #BeaverLake #Rogers #rogersAR #RogersArkansas #Bentonville #BentonvilleAR #BentonvilleArkansas #NorthwestAR #northwestarkansas #paddlejunkies #perceptionkayaks #wildernesssystemskayaks #wildernesssystems #beautifulday |
Mar 3 |
Social |
Instagram |
Solo day paddle on Biscayne Bay #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #paddling #paddlemixtape #outdoors #outdoorlife #winter #wildernesssystems #america #atlanticocean #sunscreen #f#gopro #howtodoflorida #j#kayakgram #kayaklyfe #zephyr160 #biscaynebay #miami #miamilife #smile #happiestonthewater |
Mar 3 |
Social |
Wilderness Systems Fishing Kayaks FB |
Jeff Little takes you through each step of setting up your retractable anchor system. #Radar135 https://www.youtube.com/watch?v=i4Tbnju7AII |
Mar 3 |
Social |
Instagram |
River Ratz Fishing YouTube host and outdoor writer Daniel Reach has a nice article about improving your fishing videos in the Spring 2017 online issue of Kayak Bass Fishing Magazine. They featured a few photos I did of Daniel last fall . Thanks KBF ! www.kayakbassfishing.com #river_ratz_fishing #kayakbassfishingmagazine #texasbassfishing #kayaking #kayakbassfishing #marinersails #marinersailskayakfishingclub #wildernesssystems #bendingbranchespaddles #yakattack #urbanbassfishing #txflyfishingfestival #river.ratz.txyakin#lumixgh3 #hs35100 #hs1235 #imkmark #texaskayakfisherman #kayakbassadventures #kayakbassseries #yakaddicts #fishkats |
Mar 3 |
Social |
Instagram |
Kayaking in the sound this afternoon. #avonnc #kayaking #llbean #wildernesssystems #gattoisland #nc #obx |
Mar 2 |
Forums |
/r/Kayaking |
Thoughts on a used Wilderness Systems Tarpon 100 |
Mar 2 |
Social |
Instagram |
Пополнение раздела дисконт : ✔Морской каяк WILDERNESS SYSTEMS FOCUS 150 синего цвета. Лодка участвовала в тест-драйвах на спокойной воде Подробности по ссылке в описании профиля в разделе ДИСКОНТ. #скидка #дисконт #sales #скидки #каяк #морской каяк #kayak #seakayak #морскойкаякинг #sea kayaking #kayaking #kayak |
Mar 1 |
Social |
Instagram |
Stud red for this novice fisherwoman! #kayakfishing @carmenskayaks 239-333-7332 #kayakfishingguide #kayaking #fishing #redfish #wildernesssystems #fisherwomen #stud |
Mar 1 |
Social |
Instagram |
Fishing sucked due to the wind blowing me all over the lake but it was still better than spending the day in the office. #kayaking #flyfishing #flyfishingjunkie #flyfishingscenery #wildernesssystems #clearlake #flyfishinglouisiana #louisianaflyfishing |
Mar 1 |
Social |
Wilderness Systems Fishing Kayaks FB |
'Kayak Fishing Experience' just won Best Kayak Fishing Film at this year's Reel Paddling Film Festival. If you haven't seen the video check out it now. https://youtu.be/7F5TiFHnV6A Kayak Bass Fishing Reel Paddling Film Festival #wildyfishing |
Mar 1 |
Social |
Wilderness Systems Fishing Kayaks FB |
REGISTRATION DEADLINE for 2017 KBF OPEN! |
Mar 1 |
Social |
Instagram |
The Zephyr framed between the mangroves on Chicken Key in Biscayne Bay #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #paddling #paddlemixtape #outdoors #outdoorlife #winter #wildernesssystems #america #gopro #howtodoflorida #kayaklyfe #kayakgram #zephyr160 #biscaynebay #miami #miamilife #mangroves #islandlife #chickenkey |
Mar 1 |
Social |
Instagram |
Having a great time at the first meetup of the year! More will definitely be on the way. Any suggestions of places you would like to go? . . . . . . #canoecountryfl #ccofl #kayaking #paddling #meetup #paddletrip #kayak #kayakmeetup #stpete #tampa #tampabay #clearwater #wildernesssystems #hurricane #cdkayaks |
Mar 1 |
Social |
Wilderness Systems Fishing Kayaks FB |
If you're looking to take your tournament skills to the next level then make sure you check out Extreme kayak fishing Inc. Great events and great people! |
Feb 28 |
Social |
Instagram |
The Atlantic Ocean doesn't get much calmer than this. Enjoying an early morning paddle off the coast of Virginia Key. Photo credit: @paddlesouthflorida #florida #adventure #touring #kayak #kayaking #paddle #paddling #outdoors #outdoorlife #winter #wildernesssystems #america #southflorida #sunrise #shaka #gopro #howtodoflorida #kayaklyfe #kayakgram #zephyr160 #biscaynebay #atlanticocean #miami #miamilife |
Feb 28 |
Social |
Instagram |
He's ready for this years #kayakbassfishing ! . #kayakbassin #wildernesssystems #kayakangler #nativewatercraft #nativeslayerpropel #slayerpropel13 #kayaking #kayakcamping #bassfishing #fishingwithbuddies #allaboutfishingdaily #allaboutthatbassfishing #icatchemall #fish #fishingdaily #fisherman #fishon #fishin #anglerapproved #bassgram #bassmaster #ultralightfishing #bassfishin #bassfishingnation #freshwaterfishing #freshwaterdaily #fishingtrip |
Feb 27 |
Social |
Instagram |
Cruzin around Anclote Key #kayak #kayaking #ancloteisland #wildernesssystems #saltlife #fishing |
Feb 27 |
Social |
Instagram |
#carterslake #OptOutside #roamwithlions #wildernessculture #wandernorthga #exploregeorgia #georgiaunleased #georgiacreatives #yaklife #kayak #nature #lake #wildernesssystems #tarpon100 #kayaking #optoutsidegeorgia #getoutsidegeorgia #discovering_captures #paddle #womenwhoexplore #herwanderfullife |
Feb 27 |
Social |
Instagram |
Monday and daydreaming about about this! #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #paddling #outdoors #outdoorlife #winter #wildernesssystems #paddlemixtape #southflorida #gopro #howtodoflorida #kayakgram #kayaklyfe #zephyr160 #biscaynebay #miami #miamilife #daydreaming #monday |
Feb 26 |
Social |
Instagram |
That face you make when your fishing for reds and you catch this ° #kayakfishing #kayakangler #largemouthbass #dink #gopro #goprooftheday #gopro4 #goprohero4 #fishing #outdoors #adventure #adventurer #bendingbranches #wildernessculture #tarpon120 #wildernesssystems #costadelmar #costa #skinnywaterculture #thetugisthedrug #like4like #followforfollow #followtrain #kayaking |
Feb 26 |
Social |
Instagram |
#sundayfunday #adventurethatislife #At17workout #werner #wildernesssystems #kayaking #kayakingadventures #adventurethatislife #backpacking #biking #whiteblaze #sunrise #gators #gatorbait #swampthing |
Feb 26 |
Social |
Instagram |
Awesome photo on the kayak! #flogrown #kayaking #kayakfishing #yakanglers #wildernesssystems #inshorefishing #saltwaterexperience #flatsclass #florida #skinnywaterculture #spiderwire #saltlife #yeeyee |
Feb 26 |
Social |
Instagram |
Fighting currents, chasing dolphins and seeing birds! Yaking in Florida is pretty sweet! @wildernesssystems @aquabound @mountainhardwear #kayaking #sprucecreek #water #florida #daytonabeach #beautifulflorida #getoutside #havefun #freshair #breathein #itsgreattobealive |
Feb 26 |
Social |
Instagram |
Can't wait to get back on the water. #wildernesssystems #kayak #paddling #kayaking |
Feb 26 |
Social |
Instagram |
It was an awesome day on the water! #kayak #kayaking #kayakingadventures #gulfcoast #naples #florida #saltlife #oceankayak #wildernesssystems #intothewild #explore #exploremore #outdoors #outdoorlife #getoutside #adventure #adventuretime #nature #natureonly #natureporn #naturegram #naturephotography #nature_brilliance #naturelovers #naturelover #nature_perfection #instanature #instanaturelover #sundayfunday #floridalife |
Feb 26 |
Social |
Instagram |
Heading out this morning #wildyfishing #wildernesssystems #atak120 #bbpaddles #kayakfishing #kayaking |
Feb 25 |
Social |
Instagram |
Morgantown, WV from the mighty Monongahela at the mouth of Decker's Creek. #monongahelariver #wildwonderful #wildernesssystems #kayakingadventures #kayaking |
Feb 25 |
Social |
Instagram |
At home in the mangroves. I'm sure @wildernesssystems didn't design the Zephyr to be exploring the narrow mangrove channels but it's maneuverability is great for the tight spaces #FLATkayak #adventure #touring #kayak #kayaking #miami #southflorida #paddle #paddling #paddlemixtape #outdoors #outdoorlife #winter #wildernesssystems #america #gopro #howtodoflorida #kayakgram #kayaklyfe #zephyr160 #biscaynebay #nofilter #miamilife #mangroves #shaka |
Feb 25 |
Social |
Instagram |
That was short lived. Thanks for the tease, Michigan. #snow #snowingagain #stop #wildernesssystems #aspire105 #watersports #springiscoming #kayak #kayaking #paddle #springfever #pontiacvibe #vibe #lightroomapp |
Feb 25 |
Social |
Instagram |
Celebrating each other with a maiden voyage out on Lake Lytle! ⛰☀️°°♀️ #kayaking #kayak #oregon #nature #getfit #wildernesssystems #blueskies |
Feb 25 |
Social |
Instagram |
Transportation to Anclote Key @joseph_stover #wildernesssystems #Yamaha #kayak #kayaking #camping #waverunner #saltlife #beach #islandlife #adventure |
Feb 24 |
Social |
Instagram |
Looking forward to this years fishing! . . #wildernesssystems #kayakbassin #kayakfishing #kayakangler #Radar115 #WildernessSystemsRadar115 #familyfun #kayaking #kayakcamping #bassfishing #fishingwithbuddies #allaboutfishingdaily #allaboutthatbassfishing #icatchemall #fish #fishingdaily #fisherman #fishon #fishin #anglerapproved #bassgram #bassmaster #ultralightfishing #bassfishin #bassfishingnation #freshwaterfishing #freshwaterdaily #fishingtrip |
Feb 24 |
Social |
Instagram |
First day in my @wildernesssystems Tarpon 100, he's in his #ride115x and he caught his first kayak #bass ! #kayak #kayaking #kayakfishing #wildernesssystems #tarpon #ride |
Feb 24 |
Social |
Instagram |
#kayak #wildernesssystems #tarpon120 #woodsreservoir #sunset #paddle #getoutside #greettheoutdoors #roadlesstraveled #face_of_the_earth #water_captures #waterscape #water #watercolor #watercaptures #neverstopexploring #boat #boatlife #kayakfishing #kayaking |
Feb 24 |
Social |
Instagram |
First time out in the kayak this year (Feb 22nd). A long awaited reunion. #kayak #kayaking #paddling #water #imissedthis #comeonwarmweather #kalamazooriver #twoheartedale #iphone7plus #nature #watersports #sunshine #wildernesssystems #aspire105 #bellsbrewery #bellsbeer #twohearted |
Feb 24 |
Forums |
/r/Kayaking |
Help me narrow a kayak down, please! |
Feb 24 |
Social |
Instagram |
Tbt... Priest Lake, ID. Kalispell Island!!! Paddle in camping!!! #wildernesssystems #kayaking #gopro #camping #fireside #paddle #sand #beachlife #tbt #ipadventures #getoutside |
Feb 24 |
Social |
Instagram |
Tbt...can't wait to get back to Steamboat Rock State Park in Washington State!!! #hiking #beach #tbt#ipadventures #adventure #overland #adventuretrailer #kayaking #wildernesssystems #gofsr #gopro #xterra # |
Feb 23 |
Social |
Instagram |
#kayaking #paddling #fishing #trout #kayakfishing #speckledtrout #wildernesssystems #tarpon #choctawhatcheebay #Florida #saltlife |
Feb 23 |
Social |
Instagram |
Awesome photo while on the @wildyfishing ATAK 140. This kayak has it all. #zman #wildernesssystems #kayakfishing #donray #shieldsofstrength #kayaking #inshorefishing #yakangler #spiderwire #stcroix #flatsclass #saltwaterexperience #showyourmogan |
Feb 23 |
Social |
Instagram |
A throwback to summer paddling and an excited pup! . #pug #kayaking #pets #pugsofinstagram #summerfun #megatongue #tbt #wildernesssystems #outwardhound |
Feb 22 |
Social |
Wilderness Systems Fishing Kayaks FB |
Take 5 minutes and be a part of driving the R & D process for our custom Wilderness Systems accessories! http://survey.constantcontact.com/survey/a07eduvnt9xizg1z11n/start |
Feb 22 |
Social |
Instagram |
@kla.rose_ with her first ever bass from a kayak! #kayak_fishing_Ontario #bassfishing #bass #kayaking #kayakfishing #yakfishing #supfishing #fishing #wildernesssystems #canada |
Feb 22 |
Social |
Instagram |
#ichetuckneeriver #ichetuckneespringsstatepark #fortwhite #florida #kayaking #tarpon120 #wildernesssystems #river #water #crystalclear #springs #wander #travel #fun #outside #outdoors #getoutside #greatoutdoors #blueskies #sunshine #beautiful @wildernesssystems |
Feb 22 |
Social |
Instagram |
Added two more to the fleet today! Radar 115 from #wildernesssystems Kayaks! . . #kayakbassin #kayakfishing #kayakangler #Radar115 WildernessSystemsRadar115 #familyfun #kayaking #kayakcamping #bassfishing #fishingwithbuddies #allaboutfishingdaily #allaboutthatbassfishing #icatchemall #fish #fishingdaily #fisherman #fishon #fishin #anglerapproved #bassgram #bassmaster #ultralightfishing #bassfishin #bassfishingnation #freshwaterfishing #freshwaterdaily #fishingtrip |
Feb 21 |
Social |
Instagram |
Confluence of the Cheat River and the mighty Monongahela at Point Marion, PA. #monongahelariver #kayakingadventures #kayaking #wildernesssystems #kayakgram_feature |
Feb 20 |
Social |
Instagram |
Group 1 of 2 launching this morning! Big groups heading out this week, and lots of #sunshine for them right now! #safepaddling everyone °°#itsbetterinthebahamas #kayaking #kayaktrip #kayakgram_feature #goexplore @sturgischarter @sturgischarter.school #sturgis2017 #neckykayaks #wildernesssystems @neckykayaks |
Feb 20 |
Social |
Instagram |
Happy Monday #lovefl #kayaking #kayakingadventures° #wildernesssystems #tarpon140kayak #werner #optoutside #outdoors #gatorbait #chaconation #camping #mountainscalling #At17workout #adventurethatislife #mondays #c |
Feb 20 |
Social |
Instagram |
Well that happened! Summer can't get here fast enough. ☀️°°♀️°#kayak #kayaking #wildernesssystems #oregon #getfit #nature #pamlico135t |
Feb 20 |
Social |
Instagram |
Happy President's Day! Enjoying the day off the best way I know how #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #paddling #winter #wildernesssystems #outdoors #outdoorlife #paddlemixtape #southflorida #gopro #howtodoflorida #kayakgram #kayaklyfe #zephyr160 #biscaynebay #miami #miamilife #presidentsday #USA #america #dayoff |
Feb 20 |
Social |
Instagram |
#laparguera #kayaking #parguerakayaking #epic #epicpaddles #wildernesssystems #keen #sunnyday #clouds #fun #gopro #withgoodfriends #redkayak #tarpon160 #funday |
Feb 20 |
Social |
Instagram |
... this crazy weather has me thinking crazy #notnowbutsoon #washoutthekayak in case it stays warm #springcleaning #kayaking #wildernesssystems #kayaklife #justincase #outsideisfree #planning #dreamsdocometrue |
Feb 20 |
Social |
Instagram |
What the water sees. #nature #lakes #wernerpaddles #wildernesssystems #florida #springs #getoutside |
Feb 19 |
Social |
Instagram |
#kayaking in February #wildernesssystems #tarpon100 #gopro |
Feb 19 |
Social |
Instagram |
Water is the essence of wetness. 'No direction but to follow what you know, No direction but a faith in her decision, No direction but to never fight her flow, No direction but to trust the final destination. You're a stranger til she whispers you can stay. You're a stranger til she whispers that your journey's over. Weigh your worth before her majesty, the Verde River.' - Puscifer #asrt #florida #wernerpaddles #wildernesssystems #kayak #yellow #red #blue #seattle |
Feb 19 |
Social |
Instagram |
Have not had a calm day in a long time. Which not a bad thing ° #seakayaking #seakayak #kayaking #kajak #kayak #capetownmag #lovecapetown #capetown @sawyeroars #kayakingislove @wildernesssystems |
Feb 19 |
Social |
Instagram |
A few double crested cormorants hanging out on the channel marker #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #paddling #winter #wildernesssystems #outdoors #outdoorlife #paddlemixtape #southflorida #gopro #howtodoflorida #kayaklyfe #kayaklyfe #zephyr160 #biscaynebay #miami #miamilife #manateezone |
Feb 18 |
Social |
Instagram |
Spontaneous kayak excursion on the Maumee. Who else is ready for summer? @aagale2 #kayaking #wildernesssystems #toledometroparks #middlegrounds #ohioweather |
Feb 18 |
Social |
Instagram |
What adventures are you planning? Let's get out there!!! #beach #hiking #ipadventures #love #kayaking #optoutside #overland #lake #gofsr #wildernesssystems |
Feb 18 |
Social |
Instagram |
Chetco River sup and kayak combo #wildernesssystems #sup #xcelwetsuits #perception |
Feb 18 |
Social |
Instagram |
Humans.. it's what's for dinner!! #whatareyoudoingthisweekend #wildernesssystems #tarpon140kayak #manatees #optoutside #kayakingadventures #kayaking #ocean #gators #justdoit #At17workout #mountainscalling #camping #chaconation #biking #backpacking |
Feb 18 |
Social |
Instagram |
#kayaking #amistadreservoir #optoutside #wildernesssystems |
Feb 17 |
Social |
Instagram |
Fireside kayaks!!! Find your adventure!!! #camping #paddle #kayaking #fire #campfire #love #ipadventures #beach #hiking #wildernesssystems #gofsr |
Feb 17 |
Forums |
/r/Kayaking |
Maiden voyage on my first kayak - wilderness systems zephyr 160 - taken summer 2015. |
Feb 17 |
Social |
Instagram |
The Tarpon family continually proves a fan favorite here at the shop, we've had a slew of people picking one up in various sizes this week. It's a great compromise of comfort, speed, stability, and versatility. Who out there has some good experiences in one? . . . . . . . . . #canoecountryfl #ccofl #wilderness #wildernesssystems #tarpon #wildernesstarpon #paddling #kayak #kayaking #kayakfishing #paddlefishing #florida #stpete #tampa #clearwater #tampabay #sarasota |
Feb 17 |
Social |
Instagram |
#camping #HondaElement #renogysolar #kayaking #wildernesssystems #iceholecoolers #Amistad #solarpower #optoutside #renogyadventures #offgrid @renogysolar #inmyelement |
Feb 16 |
Social |
Instagram |
Thinking about a spring Priest Lake, ID run!!! Nothing like having the Lake to yourself!!! Get out there!!! #tbt #getoutside #getoutthere #ipadventures #paddle #loveofmylife #kayaking #spring #snow #camping #hiking #wildernesssystems |
Feb 16 |
Social |
Instagram |
Humbled and honored to join the @fishingtackleunlimited prostaff representing @wildyfishing /Wilderness Systems Kayaks. #ftu #tarpon130x #fishingtackleunlimited #gear #tackle #apparel #rod #reels #shimano #simms #yeti #13fishing #columbia #shark #bass #dorado #marlin #gar #huge #kayaks #paddles #sup |
Feb 16 |
Social |
Instagram |
Another @WildernessSystems #Atak110 is heading for the water. Looking forward to the beautiful weather this weekend. #HOOK1 #kayak #Kayaking #Paddle |
Feb 16 |
Social |
Instagram |
Kayak Photography. #kayak #kayakfishing #kayaking #kayaks #fishing #canon #canon1d #canon100400 #river #lake #wildernesssystems #peddlekayak #brisbane #queensland #australia #summer #sun2sea #sunshirt #50+ #cancercouncil #sunprotection #slipslopslap |
Feb 15 |
Social |
Instagram |
Can't wait for Summer! Lake Päijänne, Jyväskylä, Finland #kayaking #wildernesssystems #capehorn17 #päijänne #freedom#outdoors #paddling #placidity |
Feb 15 |
Social |
Instagram |
Can't wait for Summer #2, Päijänne National Park, Finland #kayaking #wildernesssystems #capehorn17 #päijännenationalpark #freedom#outdoors #paddling #seakayak |
Feb 15 |
Social |
Instagram |
Trying out the #helixmd motor drive by @torqeedo from @wildyfishing in the brand new #radar115 #wildernesssystems #wildernesssystemskayaks #radarkayak #handsfree #kayaking #shiptoshoremarine Very, very impressive. I can't wait for the #peddledrive to come. |
Feb 15 |
Social |
Wilderness Systems Fishing Kayaks FB |
Never a dull moment with this crew! Chad Hoover Randy Howell, 2014 Bassmaster Classic Champion Mike Iaconelli https://youtu.be/AI0Eza_dKLM |
Feb 15 |
Social |
Instagram |
Chain Pickerel on mini Banger Fly @ Daingerfield SP TX. #onthefly #txflyfishingfestival #texasstateparks #daingerfieldstatepark #findyourwater #tforods #rioflylines #repyourwater #fortworthflyfishers #orvissouthlake #flyfishingtexas #lamsonwaterworks #wildernesssystems #wernerpaddles #thetugisthedrug #lifesbetteroutside #lumixgh3 #flyfishingjunkie #pickerel #fishporn #flytying #imkmark |
Feb 15 |
News |
Kayak Angler Magazine |
Two kayak Fishing Television series to watch out for… |
Feb 14 |
Social |
Instagram |
Spent a great weekend with my valentine and a few crazy friends kayaking , fly fishing, and enjoying the great outdoors at Daingerfield State Park TX. Thanks LM for doing our photo ! #daingerfieldstatepark #texasstateparks #lifesbetteroutside #wildernesssystems #jacksonkayak #wernerpaddles #tforods #waterworkslamson #texasflyfishing #txflyfishingfestival #runningcreek #dutchoven #rabidfly #paddletexas #lumix #chainpickerel #wildacrebrewing #exofficio #rahrbrewery #rioflylines #imkmark |
Feb 13 |
Social |
Instagram |
Beach it!!! Looking for a base camp!!! #climbing #hiking #kayaking #tbt #wildernesssystems #love #ipadventures #sandytoes |
Feb 13 |
Social |
Instagram |
Check out this pig!! If you get a chance go check out @fish_georgia. He's running a Wilderness Systems Radar!@AppLetstag #kayakfishing #fishing #bassfishing #bass #fish #kayaking #gopro #catchandrelease #largemouthbass #yakattack #angler #yaklife #bigbass #hobie #kayaklife #freshwater #kayaks #abugarcia #lunker #freshwaterfishing #kayak #nativeamerican |
Feb 13 |
Social |
Instagram |
LETS GO FISHIN'! @yakangler67 @siyakfishing #siyakfishing #screwylewylures #wildernesssystems #wildyfishing #bendingbranches #abugarcia #sixgillfishing #yaktribe #yakattack #kayak #kayaking #kayakfishing #feelfree #lowrance #powerteamlures #chevy #johnjonesautogroup |
Feb 13 |
Social |
Instagram |
$2.50 rod leashes for kayak fishing. Leash it or lose it! Will probably change out the clip for a stronger stainless steel one though. #kayakbassin #kayak #kayakfishing #fishing #kayakangler #leash #riverfishing #riverbassin #make #rodleash #fishingrod #lewsreels #powellrods #bassfishing #kayaking #paddle #fish #wildernesssystems #jacksonkayak |
Feb 12 |
Social |
Instagram |
Chilling on the flats! #flatsfishing #kayakfishing #kayaking #wildernesssystems #tarpon120 #tag #followtrain #follow #followme #like4like #fun #selfie #outdoors #fishing #fishinglife #adventure #travel #goprophotography #goproeverything #goprohero4 #photooftheday #goprooftheday #instagood #istalike #me #likeforlike |
Feb 12 |
Social |
Instagram |
Sarah's so excited to go kayaking today! #kayaking #pilotmountain #subaruoutback #malonetrailers #pilotmountainstatepark #wildernesssystems #pungo120 #tsunami125 #febuaryinnc #subaru |
Feb 12 |
Social |
Instagram |
Kayaking on the Yadkin River today. #kayaking #pilotmountain #pilotmountainstatepark #yadkinriver #yadkinriverkeeper #wildernesssystems #pungo120 |
Feb 11 |
Social |
Instagram |
Who else is ready to get back on the Water? #siyakfishing #yaktribe #kayaking #kayakfishing #kayakbassfishing #wildernesssystems #wildyfishing @orvislouisville |
Feb 11 |
Social |
Instagram |
Base camp!!! Get out there!!! #gofsr #pnw #wildernesssystems #kayaking #ipadventures #optoutside #getoutthere #freespiritrecreation #camping |
Feb 10 |
Videos |
Youtube |
Bull Redfish - Marsh Redfish on Artificial Lure Video - Personal Best Kayak Redfish |
Feb 10 |
Social |
Instagram |
#tbt to last year's Okee trip. With a federal permit we spent 3 days kayaking and camping on islands & wooden platforms in the swamp. Great times in the wild, unplugging from the world. °° The Okefenokee Swamp is a shallow, 438,000-acre, peat-filled wetland straddling the Georgia–Florida line in the United States. A majority of the swamp is protected by the Okefenokee National Wildlife Refuge and the Okefenokee Wilderness. The Okee is the largest 'blackwater' swamp in North America. . #okefenokee #okefenokeeswamp #wildernesssystems #sunset #kayaking #igersjax #roamflorida #unplugged #blackcreekoutfitters #gopro #gpotd |
Feb 10 |
Social |
Instagram |
Follow me!!! #ipadventures #camping #kayaking #wildernesssystems #pnw #gofsr |
Feb 9 |
Social |
Instagram |
Throwback Thursday. Fish thieving Osprey dive bombing my catch! Between these guys and Zipper the surly dolphin...they spoil my fishing. #saltlife #kayak #kayaking #kayakfishing #paddle #fishing #optoutside #getoutside #getoutdoors @wildernesssystems @seatosummitgear @sawyerproducts @advancedelements #exploremore #explore #florida #adventure #fun #sun @camelbak @merrelloutside #testedtough @columbia1938 @kershawknives #birds #birdsofprey #birdsofinstagram |
Feb 9 |
Social |
Instagram |
Where did my Gurgler go ? #imkmark #templeforkoutfitters #bassonthefly #txflyfishingfestival #orvissouthlake #fortworthflyfishers #flyrodbass #flytying #flyfishingjunky #brazosriver #wildernesssystems #wernerpaddles #lumixgh3 #thetugisthedrug #lifebetteroutside #flyrod #lamsonwaterworks #findyourwater #repyourwater #keepemwet #flyfishingtexas |
Feb 8 |
Social |
Instagram |
Not a bad spot today for lunch/nap. #bedrocksandals #getoutthere #kayakflorida #santaferiver #kayakgear #kayaking #paddlingmixtape #rivershoes #wildernesssystems #goalzero #goprosession |
Feb 8 |
Social |
Instagram |
Underwater shot at Ginnie Springs. #kayaking #santaferiver #kayakflorida #getoutthere #nofilter #kayakroll #flsprings #wildernesssystems |
Feb 8 |
Social |
Instagram |
#wildernesssystems #columbia #camping #kayaking #kayaklife #kayakcamping |
Feb 8 |
Social |
Instagram |
Kayak fishing the Colorado river during monsoon season⛈°⛈rod tips down boys. #mightycoloradoriver, #squawlake, #senetorswash, #coloradoriverkayaking, #coloradoriver, #yumaarizona, #monsoonseason, #kayaking, #kayakfishing, #wildernesssystems, #wildernesskayaksystems, #kayakfishingphotos, #kayakingintherain. |
Feb 8 |
Social |
Instagram |
This is where I want to be!!! ☀ Summer 2015 . #fishing #fishingislife #summer #bassfishing #largemouth #smallmouth #bassthumb #lunker #river #kayak #kayaking #canoe #kayakfishing #musky #wildernesssystems #rapids #fish #perch #fishingcanada #girlsfishtoo #girlswhofish #girlsthatfish #bestoftheday #photography #gopro #kawarthas |
Feb 7 |
Social |
Instagram |
The Wilderness System ATAK 140 front and center for tonight's seminar. Thank You GBFA for the hospitality and letting me sharing my kayak fishing passion! #wildernesssystems #wernerpaddles #localfishingclub #1stlandingguide #kayakfishing #yakattack |
Feb 7 |
Social |
Instagram |
Another successful Saturday! 15 crabs and good times on the water with friends. #budweisercrabbincrew #gopro #wildernesssystems #wildyfishing #tarpon160i #wernerpaddles #nrs #lowrance #promar #whowantstogo?! |
Feb 7 |
Press |
misc. |
Paddlesports Retailer Open For Buyer And Vendor Registration - SGB Media (press release) (subscription) (blog) |
Feb 7 |
News |
unsponsored |
Paddlesports Retailer – Registration Now Live |
Feb 6 |
Social |
Instagram |
When it looks like your paddling in a painting °Plockton #kayaking #kayak #paddling #outdoorlife #outdoors #plockton #wilderness #wildernesskayaks #loch #scotland #landscape #landscapephotography #wildernesssystems #skye |
Feb 6 |
Forums |
YakAngler |
Wilderness Helix PD, Buy in March or wait? |
Feb 5 |
Forums |
/r/kayakfishing |
Which kayak? |
Feb 5 |
Social |
Instagram |
The early summer of 2009 was the back end of a decade-long drought in southern Australia, and the Murray River took the brunt. The country's largest river by volume runs 2500km from the snowy mountains to the Southern Ocean and all but 100km at the top was without current. Nevertheless, those 79 days in Nala the Kayak gave me a love and respect for rivers that will never leave, as well as providing the second non-motorised 1000-mile + journey of #expedition1000 #adventure #murrayriver #sayyesmore @yesisadoingword #travel #australia #victoria #newsouthwales #kayaking #paddling #journey @buff_uk @powertraveller @wildernesssystems #tempest |
Feb 5 |
Social |
Instagram |
Can't sleep! Excited about Kayak Fishing with hubby tomorrow! Maybe that #canepole he found will grab a big one! ° . . #Obsessed #hubby #myman #mylove #beard #Heath #calicorock #arkansas #arkansas_life #arkansaslife #thenaturalstate #explorearkansas #outinarkansas #kayaklife #kayak #kayaking #kayakfishing #redneckway #wildernesssystems #perceptionkayaks #bendingbranches #paddleon #paddle #1st #photooftheday #like #likeforlike #like4like #getoutside |
Feb 5 |
Social |
Instagram |
Pistol took a spill over the side of the Kayak yesterday in the 40 degree weather °°°°❄°°❄°°.... It was after I got her back up in the kayak and dried off that she must have decided it was a better idea to just sit on the nice dry pine shavings rather than stand up on the edge and hang over the side ° . . #lifelessons #learnedthehardway #sillygirl #cold #overboard #splash #oops #winter #dogsofinstagram 1/2 #americanbulldog #half #bostonterrier #muttsofinstagram #dog #kayakingdogs #kayaking #kayaklife #wildernesssystems #paddleon #adventure #swimming #Pistol #WhiteRiver #arkansas #arkmophs #thenaturalstate #3rd #photooftheday #outinarkansas #getoutside |
Feb 5 |
Social |
Instagram |
“Every Man Dies, Not Every Man Really Lives.' William Wallace #Kayaking #KayakFishing #WildernessSystems #ColumbiaPFG #CharlestonAngler |
Feb 5 |
Social |
Instagram |
Tip of the day: Foam practice golf balls for scupper plugs for Kayaks! They are cheap but work as good as the expensive good quality scupper plugs! I wish I had known this a long time ago! . . . #duh #whydidntithinkofthat #kayaks #kayak #kayaklife #kayaking #gosomewhere #explore #water #paddle #paddleon #goodidea #2nd #photooftheday #golfballs #plugged #WhiteRiver #calicorock #arkansas #river #perceptionkayaks #jacksonkayaks #wildernesssystems #hobie #daggerkayaks #photo #lifehacks #lifehack #yellow #scuppers |
Feb 4 |
Social |
Instagram |
Morgantown pool of the Monongahela River at the I-68 Uffington bridge. White paint is 30' making it about 110' from roadbed to water. #monongahelariver #kayakingadventures #kayaking#wildwonderful #wildernesssystems |
Feb 3 |
Videos |
Youtube |
How to load a kayak on/off a car. Wilderness systems atak 140 |
Feb 3 |
Social |
Instagram |
It’s kayaking time. With the old St. Petersburg Pier in the background. #kayaking #kayakingadventures #thepier #stpetersburgpier #stpetersburgfl #northshorebeach #wildernesssystems |
Feb 3 |
Social |
Instagram |
We have been updating our new webpages this week and we should have them ready next week. Then we can start dreaming about summer evenings like this. #naturavivafinland #kayaking #melonta #melontaretki #Helsinki #Vuosaari #sunset #auringonlasku #myhelsinki #helsinkisecret #dayinhelsinki #balticsea #wildernesssystems #discoveringfinland #retkipaikka #suomiretki |
Feb 3 |
Social |
Instagram |
We will be offering free kayak demos this Saturday, since the weather looks to be ideal. If there is a particular boat you have been eyeing, but wanted to paddle before jumping in, or interested in the sport and would like to get your feet wet, give us a call today and let us know you'll be coming out. If there is a particular boat or board, let us know and we'll be sure to get it out there for you. Demos start at 9:30am. . . . . . . . . #canoecountryfl #ccofl #wilderness #wildernesssystems #perception #kayaks #paddleboards #sup #canoe #demo #kayakdemo #freedemo #saturday #weekend #stpete #tampa #florida #clearwater |
Feb 2 |
Social |
Instagram |
Chain Pickerel on Seaducer Fly. Looking forward to catching a few of these next weekend.#flyfishing #flyfishingtexas #thetugisthedrug #chainpickerel #orvissouthlake #rioflylines #tforods #repyourwater #texasstateparks #daingerfieldstatepark #onthefly #seaducerfly #txflyfishingfestival #fortworthflyfishers #flyfishingjunkie #wildernesssystems #kayaking #flyrods #toothyfish #canonusa #redingtongear #waterworkslamson #fishporn #imkmark |
Feb 1 |
Social |
Instagram |
Columbia, MO is a great place, making it easy to #shoplocal and #adventurelocal. Gear up at Alpine Shop and get on the water at Finger Lakes. #kayaking #floating #kayak #paddle #outdoorlife #jacksonkayak #wildernesssystems #rivers #lakes #missouri #columbia #missouristateparks #fingerlakes |
Feb 1 |
Social |
Wilderness Systems Fishing Kayaks FB |
Check out the Wilderness Systems blog to get tips and tricks from our pros, like this one from ACA kayak instructor and licensed fishing guide Juan Veruete. http://www.wildernesssystems.com/us/experience/team-blog/297/post/gear-layout-tip-netting-more-fish |
Feb 1 |
Social |
Instagram |
Always on full alert ° #kayakingdogs #dogsofinstagram #1/2 #americanbulldog #half #bostonterrier #calicorock #arkansas #arkmophs #wonderfularkansas #arkansaslife #whiteriver #getoutside #outinarkansas #outintheozarks #paddleon #kayaklife #kayaking #paddle #wildernesssystems #water #dogs #thankyou #OMTC #winter #photo #capture #kayak #gosomewhere #kayakingadventures |
Feb 1 |
Social |
Instagram |
Last night's sunset with smoke from the forest fire mixed in. It's so much more fun sitting here looking at pictures of it than it was breathing it out there last night °°° #ozarknationalforest #fire #sunset #river #sunsets #smoke #arkansas #wonderfularkansas #arkmophs #nature #whiteriver #explorearkansas #thenaturalstate #outinarkansas #kayaking #paddleon #perceptionkayaks #wildernesssystems #kayaklife #paddle #photography #2nd #photooftheday #reflection #photo #capture #gosomewhere #kayakingadventures |
Jan 30 |
Social |
Instagram |
Perfect day for a paddle ☀️°° - #kayaking #paddling #goosecreek #goosecreekstatepark #optoutside #outdoors #nature #nc #ncstateparks #washingtonnc #wildernesssystems #tarpon120 #yaklife |
Jan 30 |
Social |
Instagram |
In case anyone was wondering, I miss my kayak. Is it spring yet? #kayaking #ADK #churchofthedoublebladedpaddle #Adirondacks #Tsunami #WildernessSystems |
Jan 30 |
Social |
Wilderness Systems Fishing Kayaks FB |
Wilderness Systems Fishing Kayaks updated their cover photo. |
Jan 30 |
Social |
Instagram |
Daydreaming on a Monday #FLATkayak #florida #adventure #touring #kayak #kayaking #paddle #miami #southflorida #biscaynebay #outdoors #outdoorlife #getoutside #january #winter #endlesssummer #gopro #wildernesssystems #zephyr160 |
Jan 30 |
Social |
Instagram |
Yesterday fun day #kayaking #puertorico #guanica #gulligansisland #tarpon160 #gopro #hero4 #keen #epicpaddles #sea #wildernesssystems #sundayfunday #relaxation |
Jan 30 |
Social |
Instagram |
#kayak #kayaking #paddle #adventure #outdoors #river #savannahriver #augustaga #wildernesssystems |
Jan 30 |
Social |
Instagram |
'We sea kayaked the Green River for 150 miles. Low water dried up the clear streams we were sourcing and it took hours to drink something that didn't resemble chocolate milk. 10/10 would do it again.' ° @gabesimages - @wildernesssystems @canyonlandsnps - #adventurekayak #canyonlandsnationalpark #kayaking #paddleforever |
Jan 29 |
Social |
Instagram |
Always a good day when you can be on the ocean! #crabbing #bodegabay #doranbeach #crabfest #atleastididntcomehomeemptyhanded #nrs #wernerpaddles #promar #donttreadonfreedom #saltarmor #gopro #sorenow #wildernesssystems |
Jan 29 |
Social |
Instagram |
No fish in the boat today but it's always nice getting out there, despite the cold . This time last year this lake was frozen. #fishing #bassfishing #bass #winter #winterfishing #kayak #kayaking #kayakfishing #kayakangler #nature #sunset #freshwater #lakelife #picoftheday #ilovefishing #catchandrelease #wilderness #wildernesssystems #thegreatoutdoors #fish #sky #clouds |
Jan 29 |
Social |
Instagram |
So happy to have a wife who comes along on my adventures. Life is better with @lorihoep #kayakflorida #flsprings #kayakadventures #getoutthere #itchetucknee #wernerpaddles #wildernesssystems #liquidlogic #paddlingmixtape |
Jan 28 |
Social |
Instagram |
A moment of peace. . . . . . . . . . . . @wildernesssystems #kayak #kayaking #outdoors #nature #liveauthentic #keepitwild #thegreatoutdoors #takemoreadventures #findyourselfoutside |
Jan 28 |
Social |
Instagram |
Great seatrout caught in key largo, Florida!!! #florida #usa #bitebooster #catchoftheday #fish #fishing #nicecatch #seatrout #trout #wow #visitflorida #lure #new #instadaily #kayak #wildernesssystems #kayaking #kayakfishing #keylargo #flakeys |
Jan 28 |
Social |
Kayak Angler Magazine FB |
Have you paddled any of the newest Wilderness Systems Fishing Kayaks? Let us know what you think! #kayakfishing #kayakangler #wildernesssystems #paddleforever |
Jan 28 |
Social |
Instagram |
Hooked up on a winter time speck! #fish #kayakfishing #kayaking #wildernesssystems #tarpon120 #speckledtrout #catchandrelease #nature #outdoors #trout #saltlife #gopro #goprohero4 #beahero #goprooftheday #fishinglife #tightlines #pennreels #hookedup #fishon #river #fisherman #saltwaterfishing #like #like4like #followtrain |
Jan 28 |
Social |
Wilderness Systems Kayaks FB |
Eastern US Sales Team taking off on a three day trip to Cumberland Island. Do what you love, love what you do! #wildernesssystems #atpaddles #mustbenice |
Jan 26 |
Social |
Instagram |
#firstpaddleoftheyear . Winter is just another #paddlingseason #plumpoint New Windsor NY. This 'nice' weather was just too tempting. Took the @wildernesssystems Zephyr15.5 out for a stroll. #paddlinglife #kayaking #paddling #nooffseason #mountainhardwear #goretex #sealsprayskirt #wernerpaddles #kokatat #salamanderthrowrope #crktedc #crkt , #milspecplus #seatosummit #drybags |
Jan 26 |
Forums |
NorCal Kayak Anglers |
Re: 2016 AOTY/DOTY Awards Ceremony |
Jan 26 |
Social |
Instagram |
#tbt I'm really not sleeping. Dare you to pull my tail °#optoutside #outdoors #gatorbait #kayaking #kayakingadventures #adventurethatislife #rivers #chaconation #backpacking #wildlife #wildernesssystems #justdoit #noswimming #lovefl #floutdoors |
Jan 25 |
Social |
Instagram |
My #wcw she's my world! More #kayaking #adventures to come!! #fishing #bassfishing #kayakfishing #kayakbassfishing #flyfishing #hfe #yakattack #yakaddicts #yaktribe #wildy #wildyfishing #wildernesssystems #rawjuiceoutdoors #rawjuicefishing #oneidalake #iloveny #cny #beardnation #beardgang #beardfishing #largemouth #smallmouth #whatgetsyououtdoors #xcitebaits #kayakanglers #catchandrelease |
Jan 25 |
Social |
Instagram |
Lunch break at Castle Dome Landing, on the Colorado river⛰☀️#coloradoriver, #lowercoloradoriver, #yuma, #yumaarizona, #kayakfishing, #kayaking, #wildernesssystems, #imperialcounty, #lakemartinez. |
Jan 25 |
Social |
Instagram |
Mmmmm.... Who's that sexy paddler? Oh wait, that's my Kevin. :) #cypresstree #cypresshouse #lakemartin #thatlacommunity #breauxbridge #louisiana #explorelouisiana #explore #wander #wanderlust #waterlust #adventureisoutthere #adventurer #paddling #kayaking #spanishmoss #swamplands #bayou #wherethewildthingsare #goprooftheday #goproawards #goprohero4 #thegreatoutdoors #goproeverything #intothewild #gopro #wildernesssystems |
Jan 25 |
Social |
Instagram |
Still shot from today. I will never claim to be an expert at photography, nor do I try to be, I just hope for the best! I will say that it is nice to have a camera doing the work for you so you can enjoy what you are doing instead of trying to get one shot! #gopro #wildernesssystems #kayakflorida #kayakadventures #lumpywaters #nrs #getoutthere #fernandinabeach #kayak #wernerpaddles #kayaking #staysaltyflorida |
Jan 24 |
Social |
Instagram |
Mighty cypress and tupelo trees towering above us. #cypresstree #cypresshouse #lakemartin #thatlacommunity #breauxbridge #louisiana #explorelouisiana #explore #wander #wanderlust #waterlust #adventureisoutthere #adventurer #paddling #kayaking #spanishmoss #swamplands #bayou #wherethewildthingsare #goprooftheday #goproawards #goprohero4 #thegreatoutdoors #goproeverything #intothewild #gopro #wildernesssystems |
Jan 24 |
Press |
misc. |
1 Wilderness Systems Zephyr 155 Pro - CANOE & KAYAK |
Jan 23 |
Social |
Instagram |
Take me back to summer!!!! #kayaking #summer #onthewater #nature #optoutside #naturelovers #kayakingadventures #wildernesssystems #outdooradventures #tbt |
Jan 23 |
Social |
Instagram |
#kayaking #indianlake #wildernesssystems #ohio #ohio |
Jan 23 |
Social |
Instagram |
Took Kevin and Dr. Medina kayaking at Lake Martin today! #cypresstree #cypresshouse #lakemartin #thatlacommunity #breauxbridge #louisiana #explorelouisiana #explore #wander #wanderlust #waterlust #adventureisoutthere #adventurer #paddling #kayaking #spanishmoss #swamplands #bayou #wherethewildthingsare #goprooftheday #goproawards #goprohero4 #thegreatoutdoors #goproeverything #intothewild #gopro #wildernesssystems |
Jan 23 |
Social |
Instagram |
Swooning over Spanish moss. #cypresstree #cypresshouse #lakemartin #thatlacommunity #breauxbridge #louisiana #explorelouisiana #explore #wander #wanderlust #waterlust #adventureisoutthere #adventurer #paddling #kayaking #spanishmoss #swamplands #bayou #wherethewildthingsare #goprooftheday #goproawards #goprohero4 #thegreatoutdoors #goproeverything #intothewild #gopro #wildernesssystems |
Jan 23 |
Social |
Instagram |
We do not suggest going paddling today, the wind and waves are pretty treacherous. But when it does calm down, those looking to go offshore in a kayak should check out the Wilderness Thresher. This kayak can best be described as a beefed up Tarpon, plenty of speed to get out there, with extra stability to handle swells where it thrives. A great option for both divers and fisherman alike. . . . . . . . . . #canoecountryfl #ccofl #kayak #kayaking #paddling #wilderness #wildernesssystems #thresher #wildernessthresher #diving #fishing #kayakfishing #florida #stpete #tampa #clearwater #offshore #offshorefishing #spearfishing |
Jan 22 |
Social |
Instagram |
Got Jeff out on the water this beautiful January day. #kayak #kayaking #kayakadventure #kayakadventurer #kayaklove #adventure #paddle #outdoors #getoutdoors #thegreatoutdoors #oldtownkayaks #outdoorlife #canoe #wildernesssystems |
Jan 22 |
Social |
Instagram |
Went out and caught about 10-12 white bass on the yak today! #hookedandtagged #teamhookedandtagged #bassing #Whitebass #Yaking #Kayaking. #Kayakfishing #wildernesssystems #Wildernesskayaks #kayakbassfishing #KBFTN |
Jan 22 |
News |
Angling International |
Kayak fishing industry unifies into a council and endorses Paddlesports Retailer as its official trade show |
Jan 22 |
Social |
Instagram |
I love my #wildernesssystems kayak, but am looking for something a little bit smaller, faster, and more agile for river, lake, and/or creek kayaking. Any suggestions? #lifeoutloud #outbound #artistfound #wanderlust #nature #naturephotography #outdoors #main_vision #naturegram #instagram #earthpix #visualsoflife #visualsofearth #roamtheplanet #natgeo #natgeotravel #travelphotography #travel #earthimagined #untoldvisuals #topexplorers #earthimagined #outdoorsdventurephotos #natgeoit #kayak. #kayaking #kayakadventures #freedominwilderness #visitwilm! |
Jan 22 |
Social |
Instagram |
Hit my spot yesterday on the #kayak with my lil man ruger. Started at 8 and got back in the truck at 5. Long fun day in the #outdoors. @wildernesssystems @wernerpaddles #redheeler #kayaking #getoutside #texas |
Jan 22 |
Social |
Instagram |
Proper beaut of a day :) #riverdart #totnes #devon #kayaking #gopro #wildernesssystems |
Jan 22 |
Social |
Instagram |
My hobbies are getting too expensive #kayaking #mtg #bikes #books #hobbies #mountainbike #runner #shelfie #willrunforbling #wildernesssystems #magicthegathering #bookstagram #deathnote #oracleofdelphi #trekbikes #robopocalypse #boardgames #nike |
Jan 21 |
Social |
Instagram |
Go check these guys out!! They are puttin on a pretty bad ass yak tourny this year. Repost from @kayakfishingidaho using @RepostRegramApp - We want to welcome Idaho River Sports to the KFI Family as the AOY Title Sponsor. They have Generously donated a Wilderness Systems ATAK 120 as the AOY Prize! Go to their page give them a like and check out their shop for all of your kayak needs! They are located on Whitewater Park Blvd in Boise! Thanks again Stan and Jo! #fish #fishing #lovefishing #bass #bassfishing #ultraskiff #kayak #jacksonkayak #kayakfishing #fishinglife #goodtimes #fun #largemouthbass #follow #smallmouthbass #oopdeoopfishin #bigbass #bassmaster #2017 |
Jan 21 |
Videos |
Youtube |
KAYAK FISHING FLORIDA..MY FIRST TUNA!! |
Jan 21 |
Social |
Instagram |
Landing back at Deering Point after a great paddle #FLATkayak #kayaking #paddle #adventure #touring #florida #southflorida #miami #biscaynebay #305 #outdoors #wildernesssystems #winter #january #gopro #exercise |
Jan 21 |
Social |
Instagram |
Repost from @oopdeoopfishin using @RepostRegramApp - Go check these guys out!! They are puttin on a pretty bad ass yak tourny this year. Repost from @kayakfishingidaho using @RepostRegramApp - We want to welcome Idaho River Sports to the KFI Family as the AOY Title Sponsor. They have Generously donated a Wilderness Systems ATAK 120 as the AOY Prize! Go to their page give them a like and check out their shop for all of your kayak needs! They are located on Whitewater Park Blvd in Boise! Thanks again Stan and Jo! #fish #fishing #lovefishing #bass #bassfishing #ultraskiff #kayak #jacksonkayak #kayakfishing #fishinglife #goodtimes #fun #largemouthbass #follow #smallmouthbass #oopdeoopfishin #bigbass #bassmaster #2017'}}]}, 'config': {'viewer': null, 'csrf_token': 'rIZJZY01LVn3Z3mjQ1tmGhge9dmymlGk'}, 'qe': {'us': {'g': 'continue_vs_signup_text_test_03 |
Jan 20 |
Social |
Instagram |
Missing my second home #baileysharbor, Summer days and kayaking in Moonlight Bay @doorcounty #wildernesssystems @costasunglasses #seewhatsoutthere #doorcounty #fishing #explore #kayaking #adventure |
Jan 20 |
Social |
Instagram |
26ft swells mean no ocean time this weekend, but I can't wait to get back out there! #wildernesssystems #thresher #wildyfishing #crabbing #gopro #nrs #wernerpaddles #promar #lowrance #herecrabbycrabby #bodega |
Jan 20 |
Social |
Wilderness Systems Kayaks FB |
Protecting our public lands means more wild places to paddle! We're proud to endorse this letter to Congress. https://outdoorindustry.org/article/together-can-defend-public-lands/#policy |
Jan 19 |
Social |
Instagram |
At least I know I will always have Kayaking buddies now even when it's freezing and I can't get a human to go with me ° They passed their training! Thanks #ozarkmtc for being such an amazing place to shop! Your service is outstanding and we will never shop for Kayaks anywhere else! #OMTC #ThankYou #calicorock #arkansas #kayaks #kayaking #paddleon #bendingbranches #wildernesssystems #winter #arkansaslife #arkmophs #wonderfularkansas #usgram #whiteriver #bluffs #dogsofinstagram #bostonterrier #americanbulldog #getoutside #outintheozarks #thenaturalstate #explorearkansas #obsessed #riveraddict |
Jan 19 |
Social |
Instagram |
Be sure to stop by the Appomattox River Co. booth on Saturday and say Hi! #richmondfishingexpo #wernerpaddles #wildernesskayaks #astralbuoyancy #1stlandingguide #kayakfishing @paddleva @wernerpaddles @wildernesssystems @theirangler |
Jan 19 |
Social |
Wilderness Systems Fishing Kayaks FB |
Protecting our public lands means more places to fish! We're proud to endorse this letter to Congress. https://outdoorindustry.org/article/together-can-defend-public-lands/#policy |
Jan 19 |
Social |
Instagram |
Spring time kayak fishing in Taylor Lake, on the Colorado river. °°#picacho, #picachopeakstatepark, #taylorlake, #kayakfishing, #kayaking, #coloradoriver, #yuma, #lowercoloradoriver, #wildernesssystems, #wildernesssystemskayaks. |
Jan 19 |
Videos |
Youtube |
Fishing kayak setup/gear ( wilderness systems atak 140) |
Jan 18 |
Social |
Wilderness Systems Fishing Kayaks FB |
A Jeff Little special from Kayak Fish - Click link! - Only for the die hards! #atak140 #atpaddles #wildyfishing http://m.kayakfishmag.com/video-magazine/kfvm9-maintaining-boat-position-wind/ |
Jan 18 |
Social |
Wilderness Systems Fishing Kayaks FB |
Check out Randy Howell, 2014 Bassmaster Classic Champion and Robin Howell fishing Lake Guntersville in Wilderness Systems A.T.A.K.s! https://www.facebook.com/RandyHowellFishing/ |
Jan 18 |
Videos |
Youtube |
First bass in the new kayak! Wilderness systems atak 140 |
Jan 18 |
Social |
Instagram |
Starting the year off with our next Paddler of the Month, Jesse! An avid kayak fisherman, who has gotten comfortable with the Wilderness ATAK 140. Next time you are in the shop man, we'll get you hooked up. Feel free to tag us in your posts with either #canoecountryfl or #ccofl, and you could be the next Paddler of the Month! . . . . . . . . . #wilderness #wildernesssystems #wildernessatak #atak140 #paddlerofmonth #kayak #kayaking #kayakfishing #kayakangler #paddlefishing #florida #stpete #fishing #paddling |
Jan 16 |
Social |
Instagram |
I took advantage of a break in the torrential rain we've had lately, to get out on the water with a friend. We couldn't have asked for a nicer winter day out on the #lake. . . . . . . . . . . . #outdoors #takemoreadventures #nature #kayak #kayaking #water #paddle #findyourselfoutside #liveauthentic #wildernesssystems @wildernesssystems |
Jan 15 |
Social |
Instagram |
Our new kayak showroom is almost done being built. Everything on display, @feelfreeus @vikingkayaks @nucanoe @wildernesssystems @kakukayak and tons of #SUP too! |
Jan 15 |
Social |
Instagram |
Ducks in the mist #wildernesssystems #standuppaddle #valledebravo #paddling #kayak #kayaking |
Jan 15 |
Social |
Instagram |
Baby roosters need love too #kayakfishing #splashed #galito #wildernesssystems @wildyfishing @yaktribe @yakattack.us #visicarbon @flyingfishermansunglasses @stohlquistwaterware #puravida #yozuri @yozuri_lures 3.5' 3D popper always gets em !! #kayaking |
Jan 14 |
Social |
Instagram |
It's a wildy way of life #puravida #kayaking #kayakfishing #wildernesssystems @wildyfishing @yaktribe #nofilter @yakattack.us |
Jan 14 |
Social |
Wilderness Systems Fishing Kayaks FB |
Great review from Chad Hoover on the Wilderness Systems Commander 140 - the canoe-kayak-hybrid fishing machine! #wildyfishing #commander140 https://www.youtube.com/watch?v=u_ZQwFKRceg&feature=youtu.be |
Jan 14 |
Social |
Instagram |
Wilderness Systems kayak, $299.99! #kayaking #kayak #greensboro #triadlocalfirst |
Jan 14 |
Social |
Instagram |
Manatee encounter DeLeon Springs with @gtrid3r. #florida #kayaking #manatee #wildernesssystems #tarpon100 #tarpon130x #iphonephotography #mobilephotography #phoneonly #outdoors |
Jan 14 |
News |
unsponsored |
Paddlesports Industry Coalition Endorses Paddlesports Retailer |
Jan 13 |
Social |
Instagram |
#yakattack #kayaking #kayak #ratterrier @ratterriers_ofinstagram @ratterrierworld @welove_ratterriers @wildernesssystems #nature #wildernessculture |
Jan 13 |
Social |
Instagram |
What a great day 2 years ago °°°°°° #tarpon100 #kayaking #kayakfishing #addiction #obsessed #passion #wildernesssystems #fishing #angler #bassin #largemouth #scenic #beautiful #shimano #gloomis #stcroix #lews #outdoors #outdoorsman #nature #nj #lake #lifestyle #myescape #mauijim |
Jan 13 |
Social |
Instagram |
Not your typical 'yak dog! #wildernesssystems #wildwonderful #kayakingadventures #kayaking #tygartlake #monongahelariver |
Jan 13 |
Social |
Instagram |
I few more months til slaying season! °°❤️°°°°#proudboyfriend #girlfriend #angler #fishing #obsessed #lifestyle #addicted #passion #wackyrig #sugarstick #skeetreese #shimano #spinning #fluoro #bassfishing #swampdonkey #slab #bass #lmb #largemouth #outdoors #girlswhofish #kayaking #kayakfishing #wildernesssystems #tarpon100 #merica #usa #nature |
Jan 13 |
Press |
misc. |
Paddlesports Coalition Endorses Paddlesports Retailer As Industry's Trade Show - SGB Media (press release) (subscription) (blog) |
Jan 13 |
Social |
Instagram |
Stanky smack face !!! Get some ! Mack bite was hot this morning, lost two lures to two biggins but managed this thigh wide for din din #fotosdepesca #costarica #kayakfishing #ceromackerel #playamantas #honeyhole #CROK #costaricaoceankayaking #kayaking #paddle #wildernesssystems #tarpon120 #uglystickgx2 #yozuri @wildyfishing @yaktribe @uglystik @yozuri_lures @theyakangler |
Jan 13 |
Social |
Instagram |
#shellkeypreserve #tierraverde #gulfofmexico #kayaks #kayaking #paddling #valleyseakayaks #neckykayaks #wildernesssystems #beach #florida #fun_in_florida #hashtagflorida #igersstpete #lovefl #liveamplified #optoutside #pureflorida #paddlingmixtape #roamflorida #staysaltyflorida #upsideofflorida #waterlust |
Jan 12 |
Social |
Instagram |
Jolene's maiden voyage. #florida #outdoors #kayakfishing #kayaking #wildernesssystems #tarpon130x #kayakbassfishing #fishing |
Jan 12 |
Social |
Instagram |
I'm caught up in the speed of midterms and all I want to do is go back to one of the chilliest days✌° • • • #nature #kayak #kayaking #paddling #paddlingmixtape #sunset #sunrise #wildernesssystems #dark #schön #kajak #Wisconsin #lake #winter #sunset #nature #naturephotography #landscape #landscapephotogrpahy #optoutside #wilderness #outdoors #rei1440project #explore #photo #photography #explore #escapeandexplore #herbst #northwoods #neverstopexploring #Jillstein #like4like |
Jan 12 |
Social |
Wilderness Systems Fishing Kayaks FB |
Master the rewarding skill of winter jigging from a kayak. http://m.kayakfishmag.com/tips/tip-of-the-week/winter-jigging-techniques-for-kayakers/ |
Jan 11 |
Social |
Instagram |
#lakelucas #kayaking #sunset #wildernesssystems #pamlico |
Jan 11 |
Social |
Instagram |
Heading to the office but wishing I was out there paddling #FLATkayak #kayaking #paddle #outdoors #adventure #explore #gopro #miami #southflorida #biscaynebay #florida #nofilter #werner #wildernesssystems |
Jan 10 |
Social |
Instagram |
Last second adjustments. I'm not mad, just focused #FLATkayak #kayaking #paddle #gopro #miami #southflorida #florida #biscaynebay #winter #saltlife #wildernesssystems #kayaklyfe #miamidolphins #dolphins |
Jan 10 |
Social |
Wilderness Systems Fishing Kayaks FB |
Wildy pro staffer JD Desrosiers snow launches the new Radar 115. |
Jan 9 |
Social |
Instagram |
I just got back from kayak camping and island hopping in the Florida Panhandle and can't wait to share the pics! It turns out, adventure can be in your backyard! . Little St. George Island | Florida Panhandle | 1/6/17 . #florida #visitflorida #lovefl #adventure #camping #beach #water #wave #ocean #saltlife #northface #kayaking #kayak #wilderness #island #forgottencoast #camera #gear #nikon @visit_tally @visitflorida @wildernesssystems @thenorthface |
Jan 9 |
Social |
Instagram |
Arriving at the launch spot #FLATkayak #kayaking #paddle #adventure #outdoors #yakima #gopro #nofilter #kayakgram #kayaklyfe #saltlife #miami #southflorida #winter #wildernesssystems |
Jan 9 |
Social |
Instagram |
I'm proud to announce I am now on Team Filthy. @filthyanglers Check out filthyanglers.com for the best threads in fishing. Use promo code 'filthynick' to receive a sweet discount on your Filthy gear. #fish #fishing #bassfishing #panfishing #crappiefishing #filthyanglers #bassproshop #pline #abugarcia #biwaa #evolutionbaits #luckytacklebox #crappietacklebox #dirtydelta #filthy #dirtbag #bassaholics #hooklineandsinker #wildernesssystems #tarpon120 #kayakfishing #kayaking #certifiedfilthy |
Jan 8 |
Social |
Instagram |
#itsatopsulthing #topsailisland #kayaking #paddle #kayak #fishing #paddleti #icw #water #ocean #southern #northcarolina #wildernesssystems #thresher140 |
Jan 8 |
Social |
Instagram |
#itsatopsulthing #topsailisland #kayaking #paddle #kayak #fishing #paddleti #icw #water #ocean #southern #northcarolina #wildernesssystems #thresher140 #nofilter #tshirt #apparel |
Jan 7 |
Social |
Instagram |
A great way to start my last day in Lakeland before the spring semester! #kayaking #lakeland #lakes #wildernesssystems #backtoschool |
Jan 7 |
Videos |
Youtube |
Susquehannah River Smallmouth Bass Kayak Fishing Out of a Wilderness Systems ATAK 140 |
Jan 7 |
Social |
Instagram |
Águila ° #wildernesssystems #standuppaddle #valledebravo #paddling #kayak #kayaking |
Jan 7 |
Social |
Instagram |
Paddle, Pedal, and Power, we are thrilled to have the new Wilderness Systems Radar 135! #wildy #wildernesssystems #wildernesssystemsfishingkayaks #kayakcentreri #rhodeisland #paddleRI #kayak #getoutthere #adventure #getoutandplay #kayaking #ocean #paddle #pedal #power #newengland #boat #onthewater #kayakfishing #bassfishing |
Jan 7 |
Social |
Instagram |
The new Radar 135 from Wilderness Systems has arrived at the shop! Paddle, peddle, or motor the most versatile kayak to date. Come check it out, we've got the fire going to keep you toasty while you check out the latest kayaks and gear. |
Jan 7 |
Forums |
/r/kayakfishing |
seeking advice please! |
Jan 7 |
Social |
Instagram |
Kayak life..#kayaking #westernaustralia #wildernesssystems #ocean #sea |
Jan 6 |
News |
Kayak Angler Magazine |
Video: New Radar From Wilderness Systems |
Jan 6 |
News |
Kayak Angler Magazine |
Boat Review: Wilderness Systems' Tarpon 130x With Helix Drive |
Jan 6 |
News |
Kayak Angler Magazine |
Striper Shootout New England Style |
Jan 6 |
News |
Kayak Angler Magazine |
Wilderness Systems Award Winning Radar 115 |
Jan 6 |
News |
Kayak Angler Magazine |
New Kayak Fishing Sponsorship For Randy Howell |
Jan 6 |
News |
Kayak Angler Magazine |
Wilderness Systems Releases New A.T.A.K. 120 And Radar |
Jan 6 |
Social |
Instagram |
Wilderness Systems' New Radar Family, the first fishing kayak in their lineup to offer effortless motor or pedal drive integration. It's not half bad to paddle either. Check them out! . . . . . . . . #canoecountryfl #wilderness #wildernesssystems #radar #wildernessradar #fishingkayak #fishing #kayaking #paddling #kayakangler #pedal #motor #paddle #pedalkayak #florida #stpete #tampa #clearwater #sarasota |
Jan 6 |
Social |
Instagram |
Yakking! #explore #amazing #adventure #adventureisoutthere #getoutside #outdoors #wildernesssystems #getlost #baitcaster #swimbaits #fishing #fishingtrip #kayakbassfishing #kayaking #bassmaster #bassfishing #sunset #sunglasses #smallmouth #dropshot #kvd #13fishing #views #mothernature #naturephotography #glidebait |
Jan 5 |
Forums |
YakAngler |
Ride 135 Possible Trade??? |
Jan 4 |
Social |
Instagram |
I miss the warm weather! #outdoors #wildernessculture #getoutside #explore #mothernature #naturephotography #fishingtrip #fishing #bassfishing #bassmaster #kayaking #kayakbassfishing #largemouthbass #glidebait #pond #baitcaster #droptop #smallmouth #abugarcia #clouds #sunset #summer16 #views #shadows #swimbaits #bigbaits #getlost #wildernesssystems #summer17 |
Jan 4 |
Social |
Instagram |
My ride!°°° #tarpon100 #kayakbassfishing #kayaking #peacockbass #getoutside #sixgillfishing #trout #swimbaits #bass #bassfishing #bassmaster #wildernessculture #fishing #fishingtrip #smallmouth #wildernesssystems #abugarcia #kvd #droptop #baitcaster #pond #lake #goodtimes #camping #glidebait #outdoors @wildyfishing #tackleWarehouse |
Jan 3 |
Social |
Instagram |
Kayak fishing - going where others can't, when others won't, in the pursuit of adventure. #kayak #kayakfishing #fishing #kayakangler #jacksonkayak #wildernesssystems #scottyfishing #kayakbassin #catfish #bass #bassfishing #ohiofishing #gofishing #coosa #tarpon120 #yakattack #winterfishing #berkleyfishing #luckytacklebox #allprorods #lews #lewsreels #shimano #shimanofishing #winter #determination @frank_teague |
Jan 2 |
Social |
Instagram |
Superman has his cape. I have a drysuit. ° . . . . . . . . #lifeofadventure #winterkayaking #churchofthedoublebladedpaddle #livingthedream #winter #snow #kayak #kayaking #paddle #paddling #livingthedreamadventures #kokatat #nrs #wildernesssystems #wernerpaddles #westsalem #wisconsin #adventure #exploring #explore #ccakc #drysuit #happynewyear #newyear #newyearsday |
Jan 2 |
Social |
Instagram |
Happy New year °°#ocean #kayaking #westernaustralia #wildernesssystems #island #sea #beach #islandlife |
Jan 2 |
Social |
Instagram |
Starting off 2017 right! #FLATkayak #kayaking #2017 #paddle #miami #southflorida #biscaynebay #mangroves #wildernesssystems #zephyr160 #gopro #aventures #outdoorlife #kayaklyfe |
Jan 2 |
Social |
Instagram |
A closer look at the seating system on the @perceptionkayak Pescador pilot 12.0 pedal drive kayak. Super easy adjustment system utilizing a track system on the center console and two adjustment knobs. #wildernesssystems #iphone #quiversports #quiver_sports #goprohero5 #kayakfishing #kayaking #pedaldrive #perceptionkayaks #confluenceoutdoors #kayaking #2017 #happynewyear #sonar #midnightblue |
Jan 2 |
Social |
Instagram |
The kayaks get their own boat slip off the canal. #floridakeys #bigpinekey #wildernesssystems #kayaking |
Jan 1 |
Social |
Instagram |
So far my #2017 #exercise schedule is perfect!° I did a 5.4 mile #paddle in the #kayak, fighting the wind in the #intercoastalwaterway then went for a three mile walk to the beach with Jennifer of @amazingstreetpainting. The high light was seeing an otter in the Intercoastal. Fantastic, but windy weather in #southflorida for #newyearsday. What did you do today? Let us know by writing a comment below. Let 2017 be great. #happynewyear #kayaking #paddling #currentdesigns ##boating #funoutdoors #floridaoutside #floridaliving #floridaoutdoors #funinthesun #floridafun #sunshinestate #sunshineandfreshair #oldtowncanoe #wildernesssystems |
Jan 1 |
Social |
Instagram |
Today's Paddle on Skidaway River!!! #skidawayisland #skidawayriver #kayaklife #kayaking #paddlingga #paddlelife #perceptionkayaks #wildernesssystems #tsunami175 #carolina14 |
Jan 1 |
Social |
Instagram |
Skidaway River!! #kayaking #kayaklife #kayakgram #paddlingga #skidawayisland #skidawayriver #wildernesssystems #tsunami175 |